Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PYW5

Protein Details
Accession A0A3F3PYW5   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
109-129PTVPNPANRRHFKKAPIRVKEHydrophilic
NLS Segment(s)
PositionSequence
99-107KVKSPRLGR
112-128PNPANRRHFKKAPIRVK
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MIGDGIGNSNGDLTPDTISPGEIGGLREVHRLPNMSQLYKKPSIQRATYLSYSESASPNDNLSNKQQQQQNKEHTELLPSESPPTASTKPNLKNRVNHKVKSPRLGRYPTVPNPANRRHFKKAPIRVKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.11
5 0.12
6 0.11
7 0.1
8 0.1
9 0.09
10 0.1
11 0.1
12 0.11
13 0.12
14 0.15
15 0.15
16 0.17
17 0.18
18 0.19
19 0.18
20 0.26
21 0.29
22 0.29
23 0.32
24 0.33
25 0.38
26 0.4
27 0.43
28 0.4
29 0.44
30 0.47
31 0.45
32 0.46
33 0.43
34 0.43
35 0.41
36 0.35
37 0.28
38 0.24
39 0.23
40 0.2
41 0.17
42 0.13
43 0.13
44 0.13
45 0.13
46 0.14
47 0.14
48 0.14
49 0.17
50 0.24
51 0.24
52 0.29
53 0.33
54 0.36
55 0.42
56 0.48
57 0.52
58 0.47
59 0.48
60 0.44
61 0.4
62 0.37
63 0.31
64 0.26
65 0.2
66 0.17
67 0.17
68 0.15
69 0.15
70 0.14
71 0.18
72 0.17
73 0.18
74 0.21
75 0.28
76 0.37
77 0.45
78 0.53
79 0.53
80 0.58
81 0.66
82 0.73
83 0.72
84 0.66
85 0.67
86 0.69
87 0.7
88 0.72
89 0.69
90 0.66
91 0.66
92 0.7
93 0.63
94 0.6
95 0.63
96 0.6
97 0.63
98 0.59
99 0.57
100 0.61
101 0.67
102 0.69
103 0.7
104 0.71
105 0.72
106 0.74
107 0.77
108 0.79
109 0.81