Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3PU78

Protein Details
Accession A0A3F3PU78    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-34NNNAISPVSNRRRRRPRSSTSFRTQSHydrophilic
NLS Segment(s)
PositionSequence
21-23RRR
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MSLVCETANNNAISPVSNRRRRRPRSSTSFRTQSLFCSFLVSLRGLNLVRELVTCYYLSWWLLSSVEIRSDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.26
3 0.31
4 0.4
5 0.47
6 0.57
7 0.68
8 0.75
9 0.82
10 0.82
11 0.82
12 0.83
13 0.86
14 0.84
15 0.82
16 0.79
17 0.69
18 0.62
19 0.52
20 0.45
21 0.39
22 0.32
23 0.23
24 0.2
25 0.18
26 0.16
27 0.18
28 0.14
29 0.11
30 0.1
31 0.12
32 0.1
33 0.1
34 0.1
35 0.09
36 0.09
37 0.09
38 0.11
39 0.09
40 0.11
41 0.11
42 0.1
43 0.11
44 0.12
45 0.12
46 0.11
47 0.11
48 0.1
49 0.11
50 0.11
51 0.11
52 0.12