Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PIY0

Protein Details
Accession A0A3F3PIY0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAAKKRSIRRRRPSSKRSTYQQRTRRKNSLFHydrophilic
NLS Segment(s)
PositionSequence
4-18KKRSIRRRRPSSKRS
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MAAKKRSIRRRRPSSKRSTYQQRTRRKNSLFLKAFEYCNLCEADIALWHPSREELVGSLYDSLKDTSYPKPREITWGELAAQYEMWEAKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.91
4 0.9
5 0.9
6 0.89
7 0.89
8 0.87
9 0.87
10 0.86
11 0.87
12 0.86
13 0.79
14 0.78
15 0.75
16 0.76
17 0.69
18 0.61
19 0.58
20 0.51
21 0.47
22 0.4
23 0.35
24 0.24
25 0.21
26 0.2
27 0.14
28 0.11
29 0.11
30 0.09
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.07
43 0.07
44 0.08
45 0.09
46 0.08
47 0.09
48 0.09
49 0.1
50 0.09
51 0.1
52 0.12
53 0.19
54 0.29
55 0.32
56 0.34
57 0.37
58 0.37
59 0.44
60 0.45
61 0.44
62 0.38
63 0.37
64 0.35
65 0.34
66 0.34
67 0.27
68 0.23
69 0.16
70 0.14