Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3Q2U0

Protein Details
Accession A0A3F3Q2U0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-69LLLVRGRRPSHRKGRREGVRDPBasic
NLS Segment(s)
PositionSequence
52-64RGRRPSHRKGRRE
Subcellular Location(s) nucl 13, cyto_nucl 11, cyto 7, mito 3, plas 1, extr 1, pero 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MDADPVPVITLVLMWLSSLKLDLKLSLFSPSAAFCLDSQSSPELWNKLLLVRGRRPSHRKGRREGVRDPDKLTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.05
5 0.06
6 0.07
7 0.08
8 0.09
9 0.1
10 0.11
11 0.12
12 0.13
13 0.14
14 0.14
15 0.12
16 0.12
17 0.11
18 0.11
19 0.1
20 0.1
21 0.07
22 0.1
23 0.1
24 0.1
25 0.11
26 0.11
27 0.11
28 0.12
29 0.14
30 0.12
31 0.12
32 0.13
33 0.12
34 0.12
35 0.16
36 0.18
37 0.23
38 0.28
39 0.37
40 0.41
41 0.5
42 0.56
43 0.61
44 0.69
45 0.73
46 0.74
47 0.75
48 0.8
49 0.81
50 0.81
51 0.79
52 0.79
53 0.78
54 0.74