Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3PRQ5

Protein Details
Accession A0A3F3PRQ5   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
151-175VHQTKQGPPQQPSKKSKKKSKAEEAHydrophilic
NLS Segment(s)
PositionSequence
163-172SKKSKKKSKA
Subcellular Location(s) cyto 12.5cyto_nucl 12.5, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MSEPLTKVDSAIAISPRDEKAPDKDAKKGHRRTSSHAEGVYNIKELEEKKIEITLPIETQKTGWKLNTSPSTIEDKDILKLHLINPPVKKIDLHFPLGLEVTARNMKGVTIKDALDAIYKQFKKKADDELDKPYLAGFEWDKDECWTRLIVHQTKQGPPQQPSKKSKKKSKAEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.2
4 0.21
5 0.22
6 0.22
7 0.25
8 0.33
9 0.39
10 0.39
11 0.45
12 0.51
13 0.59
14 0.66
15 0.69
16 0.7
17 0.72
18 0.74
19 0.75
20 0.77
21 0.74
22 0.68
23 0.61
24 0.52
25 0.44
26 0.44
27 0.37
28 0.28
29 0.21
30 0.16
31 0.17
32 0.17
33 0.21
34 0.2
35 0.19
36 0.18
37 0.21
38 0.21
39 0.19
40 0.19
41 0.15
42 0.15
43 0.16
44 0.16
45 0.14
46 0.15
47 0.18
48 0.2
49 0.2
50 0.19
51 0.2
52 0.2
53 0.27
54 0.31
55 0.28
56 0.26
57 0.27
58 0.31
59 0.29
60 0.29
61 0.24
62 0.2
63 0.21
64 0.21
65 0.18
66 0.13
67 0.13
68 0.14
69 0.15
70 0.16
71 0.18
72 0.18
73 0.2
74 0.21
75 0.2
76 0.19
77 0.17
78 0.24
79 0.23
80 0.24
81 0.22
82 0.21
83 0.21
84 0.21
85 0.19
86 0.11
87 0.08
88 0.08
89 0.09
90 0.09
91 0.08
92 0.08
93 0.09
94 0.12
95 0.13
96 0.14
97 0.15
98 0.15
99 0.15
100 0.16
101 0.16
102 0.13
103 0.13
104 0.11
105 0.18
106 0.2
107 0.21
108 0.25
109 0.29
110 0.33
111 0.36
112 0.44
113 0.45
114 0.51
115 0.53
116 0.57
117 0.56
118 0.5
119 0.47
120 0.37
121 0.27
122 0.2
123 0.19
124 0.12
125 0.11
126 0.15
127 0.15
128 0.16
129 0.18
130 0.23
131 0.2
132 0.2
133 0.19
134 0.18
135 0.23
136 0.31
137 0.34
138 0.35
139 0.42
140 0.46
141 0.49
142 0.55
143 0.57
144 0.55
145 0.54
146 0.6
147 0.62
148 0.68
149 0.73
150 0.77
151 0.8
152 0.83
153 0.9
154 0.9
155 0.91