Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3PKI5

Protein Details
Accession A0A3F3PKI5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-85ERNLASYKKKIQQKAKKEAKVAHKKAHydrophilic
NLS Segment(s)
PositionSequence
67-87KKKIQQKAKKEAKVAHKKASP
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MINPWYAEYLQAEQKRRCASVKHEDPETDNDVPLALNGRKLPKASETAIGEKPGSDVPIERNLASYKKKIQQKAKKEAKVAHKKASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.46
4 0.45
5 0.42
6 0.44
7 0.48
8 0.55
9 0.52
10 0.51
11 0.49
12 0.49
13 0.49
14 0.46
15 0.36
16 0.26
17 0.22
18 0.19
19 0.18
20 0.15
21 0.14
22 0.09
23 0.1
24 0.12
25 0.15
26 0.16
27 0.16
28 0.17
29 0.16
30 0.19
31 0.18
32 0.21
33 0.21
34 0.24
35 0.24
36 0.24
37 0.22
38 0.18
39 0.18
40 0.14
41 0.12
42 0.08
43 0.08
44 0.1
45 0.17
46 0.18
47 0.17
48 0.19
49 0.21
50 0.26
51 0.29
52 0.31
53 0.32
54 0.39
55 0.47
56 0.54
57 0.63
58 0.68
59 0.75
60 0.81
61 0.84
62 0.83
63 0.82
64 0.81
65 0.81
66 0.82
67 0.78