Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3F3PYH8

Protein Details
Accession A0A3F3PYH8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-67CMPAKGTQPARKKKRRWGEEAKKRKEKEYBasic
NLS Segment(s)
PositionSequence
47-65PARKKKRRWGEEAKKRKEK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MDEDNRIKRTEYERAADANICTSNVSVSQQMWNPREVSCMPAKGTQPARKKKRRWGEEAKKRKEKEYIPPLIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.38
4 0.32
5 0.25
6 0.2
7 0.17
8 0.14
9 0.12
10 0.11
11 0.1
12 0.11
13 0.09
14 0.09
15 0.12
16 0.15
17 0.21
18 0.22
19 0.23
20 0.22
21 0.21
22 0.23
23 0.21
24 0.21
25 0.17
26 0.17
27 0.17
28 0.2
29 0.21
30 0.24
31 0.32
32 0.37
33 0.44
34 0.53
35 0.62
36 0.68
37 0.75
38 0.8
39 0.83
40 0.83
41 0.83
42 0.84
43 0.85
44 0.86
45 0.9
46 0.9
47 0.89
48 0.83
49 0.79
50 0.76
51 0.71
52 0.71
53 0.71