Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3F3Q317

Protein Details
Accession A0A3F3Q317    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-68VQFLFFPSCRHKKKKKTFLSCLYGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto_mito 6.5, mito 6, cyto 5, golg 2, plas 1, pero 1, E.R. 1, cysk 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEHWLTLSLTHTPPSPSDNPLLHLMGLFRSRVCILHLYGPIPSVQFLFFPSCRHKKKKKTFLSCLYGSLPSFFPYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.23
4 0.28
5 0.27
6 0.29
7 0.3
8 0.29
9 0.23
10 0.2
11 0.18
12 0.15
13 0.15
14 0.12
15 0.09
16 0.1
17 0.1
18 0.11
19 0.12
20 0.11
21 0.11
22 0.16
23 0.17
24 0.15
25 0.15
26 0.15
27 0.14
28 0.12
29 0.11
30 0.07
31 0.06
32 0.06
33 0.07
34 0.11
35 0.12
36 0.15
37 0.23
38 0.32
39 0.4
40 0.5
41 0.59
42 0.66
43 0.77
44 0.84
45 0.87
46 0.88
47 0.9
48 0.9
49 0.87
50 0.78
51 0.7
52 0.62
53 0.54
54 0.44
55 0.37
56 0.28