Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367XWE9

Protein Details
Accession A0A367XWE9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-33DFFSKSTPKAKRVKVGKTKVMKPVDHydrophilic
NLS Segment(s)
PositionSequence
18-23AKRVKV
Subcellular Location(s) mito 14, mito_nucl 11.666, cyto_mito 10.166, nucl 8, cyto_nucl 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR002043  UDG_fam1  
IPR005122  Uracil-DNA_glycosylase-like  
IPR036895  Uracil-DNA_glycosylase-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0004844  F:uracil DNA N-glycosylase activity  
GO:0006284  P:base-excision repair  
Pfam View protein in Pfam  
PF03167  UDG  
CDD cd10027  UDG-F1-like  
Amino Acid Sequences MSKRVLITDFFSKSTPKAKRVKVGKTKVMKPVDIKKDVTNGEATRVQEPVKEEKPQEEPVVESETKSDGNSENYDEFCKKYNFNKSKWVESLTPEQKDLLSLEIENIHITWLVFLHKELTKPYFLKLKKFLKSQLGKTIYPPAHQIYSWSHLTPLPDVKCLIIGQDPYHGANQAHGLAFSVLEPTRPPPSLVNIYKTIGTDYPDFKVPDSAKQQGGGNLTKWAKRGVLMLNAVLTVEAHKANSHANQGWEEFTENVIKHVIEFHKDDALVIMAWGSPAQRRVAKFKTVSNKDHFLVLRTVHPSPLSAYRGFFDLKVFLQCNDFLDKHQKDKIDWGLVEGNIVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.43
4 0.5
5 0.56
6 0.64
7 0.72
8 0.79
9 0.8
10 0.82
11 0.83
12 0.83
13 0.83
14 0.83
15 0.79
16 0.73
17 0.7
18 0.7
19 0.7
20 0.67
21 0.62
22 0.56
23 0.57
24 0.54
25 0.48
26 0.44
27 0.36
28 0.35
29 0.36
30 0.34
31 0.28
32 0.29
33 0.27
34 0.23
35 0.27
36 0.3
37 0.3
38 0.35
39 0.35
40 0.38
41 0.43
42 0.44
43 0.43
44 0.35
45 0.32
46 0.29
47 0.34
48 0.29
49 0.24
50 0.21
51 0.2
52 0.2
53 0.18
54 0.18
55 0.13
56 0.17
57 0.19
58 0.21
59 0.21
60 0.21
61 0.25
62 0.24
63 0.23
64 0.24
65 0.25
66 0.26
67 0.32
68 0.42
69 0.46
70 0.48
71 0.57
72 0.56
73 0.61
74 0.6
75 0.57
76 0.48
77 0.45
78 0.52
79 0.48
80 0.46
81 0.39
82 0.36
83 0.32
84 0.3
85 0.26
86 0.17
87 0.11
88 0.09
89 0.1
90 0.1
91 0.1
92 0.09
93 0.09
94 0.07
95 0.07
96 0.07
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.1
103 0.12
104 0.13
105 0.15
106 0.17
107 0.21
108 0.21
109 0.24
110 0.29
111 0.29
112 0.35
113 0.41
114 0.47
115 0.48
116 0.51
117 0.54
118 0.56
119 0.6
120 0.58
121 0.58
122 0.55
123 0.49
124 0.47
125 0.51
126 0.42
127 0.36
128 0.34
129 0.27
130 0.23
131 0.22
132 0.23
133 0.17
134 0.21
135 0.21
136 0.19
137 0.18
138 0.18
139 0.19
140 0.18
141 0.21
142 0.17
143 0.17
144 0.17
145 0.16
146 0.16
147 0.15
148 0.14
149 0.1
150 0.1
151 0.09
152 0.11
153 0.11
154 0.11
155 0.12
156 0.12
157 0.1
158 0.1
159 0.11
160 0.1
161 0.09
162 0.08
163 0.08
164 0.06
165 0.06
166 0.06
167 0.07
168 0.06
169 0.06
170 0.07
171 0.08
172 0.11
173 0.12
174 0.13
175 0.12
176 0.17
177 0.25
178 0.26
179 0.28
180 0.27
181 0.28
182 0.27
183 0.27
184 0.23
185 0.16
186 0.16
187 0.15
188 0.15
189 0.15
190 0.18
191 0.18
192 0.17
193 0.22
194 0.21
195 0.25
196 0.28
197 0.31
198 0.28
199 0.29
200 0.3
201 0.27
202 0.3
203 0.25
204 0.2
205 0.23
206 0.25
207 0.25
208 0.25
209 0.23
210 0.2
211 0.19
212 0.22
213 0.19
214 0.22
215 0.21
216 0.2
217 0.19
218 0.18
219 0.17
220 0.13
221 0.1
222 0.06
223 0.07
224 0.07
225 0.07
226 0.07
227 0.08
228 0.11
229 0.14
230 0.18
231 0.18
232 0.2
233 0.21
234 0.22
235 0.22
236 0.2
237 0.19
238 0.15
239 0.14
240 0.16
241 0.14
242 0.14
243 0.14
244 0.13
245 0.12
246 0.18
247 0.18
248 0.18
249 0.2
250 0.21
251 0.23
252 0.23
253 0.22
254 0.17
255 0.16
256 0.12
257 0.1
258 0.09
259 0.06
260 0.06
261 0.06
262 0.06
263 0.08
264 0.1
265 0.15
266 0.19
267 0.22
268 0.31
269 0.35
270 0.43
271 0.44
272 0.49
273 0.56
274 0.6
275 0.64
276 0.62
277 0.63
278 0.55
279 0.58
280 0.51
281 0.43
282 0.39
283 0.34
284 0.33
285 0.32
286 0.32
287 0.28
288 0.28
289 0.25
290 0.25
291 0.3
292 0.29
293 0.26
294 0.26
295 0.25
296 0.27
297 0.28
298 0.24
299 0.19
300 0.18
301 0.18
302 0.23
303 0.24
304 0.22
305 0.24
306 0.24
307 0.25
308 0.28
309 0.27
310 0.25
311 0.35
312 0.38
313 0.42
314 0.46
315 0.47
316 0.42
317 0.51
318 0.54
319 0.52
320 0.47
321 0.45
322 0.45
323 0.41