Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YBC5

Protein Details
Accession A0A367YBC5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-32QPSIKKVRNTWRLKKFKQLYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto_mito 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MLYALATPGSAFQPSIKKVRNTWRLKKFKQLYIEKGGYSSGSSMASSGSSSASNESKFSSSNSSVVTASSSTRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.3
3 0.34
4 0.36
5 0.43
6 0.53
7 0.6
8 0.63
9 0.7
10 0.73
11 0.77
12 0.77
13 0.81
14 0.77
15 0.72
16 0.72
17 0.68
18 0.63
19 0.61
20 0.59
21 0.49
22 0.42
23 0.37
24 0.27
25 0.2
26 0.15
27 0.08
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.09
39 0.11
40 0.12
41 0.13
42 0.14
43 0.15
44 0.15
45 0.17
46 0.21
47 0.21
48 0.22
49 0.23
50 0.23
51 0.22
52 0.22
53 0.22
54 0.16