Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NYZ4

Protein Details
Accession B8NYZ4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-31PATSRAIKEHSRKRHPSPQCKGVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 9, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MLLCNLFPATSRAIKEHSRKRHPSPQCKGVASLSRSHLNAESPLVDSKPIYLHQASDCSSMECHPRIERGKAVSRRSRITARIERCRLIQRFFRRTPHKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.44
3 0.51
4 0.57
5 0.63
6 0.69
7 0.75
8 0.81
9 0.84
10 0.85
11 0.84
12 0.82
13 0.78
14 0.71
15 0.65
16 0.6
17 0.56
18 0.47
19 0.43
20 0.37
21 0.34
22 0.32
23 0.31
24 0.27
25 0.21
26 0.19
27 0.16
28 0.13
29 0.12
30 0.12
31 0.11
32 0.1
33 0.09
34 0.09
35 0.09
36 0.09
37 0.1
38 0.1
39 0.11
40 0.11
41 0.14
42 0.14
43 0.15
44 0.15
45 0.13
46 0.14
47 0.14
48 0.17
49 0.16
50 0.17
51 0.15
52 0.22
53 0.25
54 0.28
55 0.31
56 0.32
57 0.41
58 0.46
59 0.54
60 0.55
61 0.57
62 0.57
63 0.59
64 0.59
65 0.54
66 0.57
67 0.58
68 0.59
69 0.64
70 0.65
71 0.62
72 0.61
73 0.66
74 0.61
75 0.57
76 0.58
77 0.58
78 0.63
79 0.67
80 0.72