Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367Y322

Protein Details
Accession A0A367Y322    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-30AAADSQNNKKRSNRRRKKRRTEDFSSSSEHydrophilic
NLS Segment(s)
PositionSequence
10-21KKRSNRRRKKRR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MAAADSQNNKKRSNRRRKKRRTEDFSSSSESSSSSDSEQEQDEEDPHQPEESGEAPATQDNINIDDMEIDSDNEAENRDKIPDDLTIEQKRQLNDFAFTTTPVSNLTNEQQQIKNLSNLNEITATLNQTKQKLNNDFLKVMTNEFNDDLDEFRTKPDFKSLVLLAKTLQLGLNMFDVDTLTDMLEEEEGGSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.88
4 0.94
5 0.97
6 0.97
7 0.97
8 0.95
9 0.92
10 0.91
11 0.85
12 0.78
13 0.74
14 0.63
15 0.52
16 0.43
17 0.35
18 0.26
19 0.22
20 0.19
21 0.13
22 0.14
23 0.14
24 0.16
25 0.16
26 0.16
27 0.15
28 0.15
29 0.15
30 0.15
31 0.17
32 0.16
33 0.16
34 0.15
35 0.13
36 0.13
37 0.14
38 0.13
39 0.12
40 0.11
41 0.1
42 0.11
43 0.11
44 0.13
45 0.1
46 0.1
47 0.08
48 0.1
49 0.1
50 0.1
51 0.09
52 0.08
53 0.08
54 0.08
55 0.08
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.08
65 0.09
66 0.09
67 0.09
68 0.1
69 0.1
70 0.13
71 0.15
72 0.21
73 0.23
74 0.23
75 0.27
76 0.28
77 0.27
78 0.25
79 0.25
80 0.19
81 0.18
82 0.18
83 0.16
84 0.14
85 0.14
86 0.14
87 0.11
88 0.11
89 0.11
90 0.11
91 0.1
92 0.11
93 0.12
94 0.14
95 0.15
96 0.18
97 0.18
98 0.18
99 0.21
100 0.21
101 0.23
102 0.21
103 0.21
104 0.21
105 0.2
106 0.2
107 0.17
108 0.16
109 0.14
110 0.13
111 0.14
112 0.12
113 0.16
114 0.17
115 0.19
116 0.22
117 0.25
118 0.33
119 0.36
120 0.4
121 0.45
122 0.46
123 0.45
124 0.42
125 0.42
126 0.34
127 0.31
128 0.28
129 0.22
130 0.2
131 0.19
132 0.19
133 0.15
134 0.15
135 0.14
136 0.13
137 0.14
138 0.12
139 0.14
140 0.18
141 0.18
142 0.19
143 0.26
144 0.26
145 0.24
146 0.3
147 0.3
148 0.33
149 0.33
150 0.32
151 0.24
152 0.26
153 0.25
154 0.2
155 0.18
156 0.12
157 0.12
158 0.13
159 0.14
160 0.1
161 0.1
162 0.09
163 0.09
164 0.08
165 0.09
166 0.08
167 0.06
168 0.06
169 0.07
170 0.07
171 0.07
172 0.07