Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YKT4

Protein Details
Accession A0A367YKT4   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
118-146TREPLYQVVRKRQRCRRKKTYNVEPFQTVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MFRSIIGSAVRPASVLSTARAYSTAVPAAATASPTAALKFTSNGSRDLYAIMKIHNMPYLVTKGDKVYLPYRLKKAAVGDVLNITEVTTLGTPSYTMNAKEGISPELYDLKASVIEITREPLYQVVRKRQRCRRKKTYNVEPFQTVLRINELKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.16
5 0.16
6 0.17
7 0.17
8 0.17
9 0.15
10 0.17
11 0.16
12 0.13
13 0.12
14 0.12
15 0.13
16 0.12
17 0.11
18 0.08
19 0.07
20 0.07
21 0.08
22 0.08
23 0.07
24 0.08
25 0.08
26 0.09
27 0.11
28 0.16
29 0.17
30 0.19
31 0.2
32 0.2
33 0.2
34 0.2
35 0.19
36 0.15
37 0.15
38 0.13
39 0.13
40 0.13
41 0.14
42 0.14
43 0.13
44 0.11
45 0.13
46 0.14
47 0.13
48 0.13
49 0.13
50 0.11
51 0.13
52 0.13
53 0.14
54 0.15
55 0.23
56 0.27
57 0.31
58 0.33
59 0.34
60 0.33
61 0.32
62 0.31
63 0.26
64 0.23
65 0.19
66 0.17
67 0.15
68 0.15
69 0.14
70 0.11
71 0.08
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.07
82 0.08
83 0.08
84 0.09
85 0.1
86 0.11
87 0.12
88 0.13
89 0.13
90 0.12
91 0.12
92 0.12
93 0.14
94 0.13
95 0.12
96 0.11
97 0.1
98 0.09
99 0.09
100 0.1
101 0.08
102 0.09
103 0.1
104 0.12
105 0.13
106 0.13
107 0.13
108 0.14
109 0.17
110 0.21
111 0.28
112 0.36
113 0.45
114 0.55
115 0.64
116 0.72
117 0.79
118 0.85
119 0.89
120 0.89
121 0.9
122 0.92
123 0.93
124 0.93
125 0.93
126 0.9
127 0.85
128 0.76
129 0.66
130 0.57
131 0.49
132 0.39
133 0.3
134 0.29
135 0.26