Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NBA6

Protein Details
Accession B8NBA6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPKKNGWLGKKRREKDNGSRGGABasic
NLS Segment(s)
PositionSequence
9-15GKKRREK
Subcellular Location(s) mito 10.5, mito_nucl 9.833, nucl 8, cyto_nucl 6.833, cyto 4.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPKKNGWLGKKRREKDNGSRGGADDAEGGQTNNGLNPMASTGVLGSGFGGAAVGLTFFFPSKKLSDFTNWIRTCLDYSSFVIYYGLVKLQGDLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.82
4 0.8
5 0.74
6 0.69
7 0.6
8 0.54
9 0.44
10 0.34
11 0.23
12 0.14
13 0.12
14 0.1
15 0.09
16 0.07
17 0.07
18 0.07
19 0.06
20 0.06
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.05
27 0.05
28 0.04
29 0.05
30 0.05
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.03
44 0.03
45 0.04
46 0.05
47 0.07
48 0.09
49 0.11
50 0.12
51 0.15
52 0.2
53 0.26
54 0.32
55 0.4
56 0.39
57 0.38
58 0.38
59 0.36
60 0.33
61 0.29
62 0.25
63 0.18
64 0.19
65 0.22
66 0.22
67 0.21
68 0.2
69 0.17
70 0.16
71 0.14
72 0.13
73 0.1
74 0.1