Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YEA7

Protein Details
Accession A0A367YEA7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
91-120GDEPEKPNNNPEKKKKGRSQKSKPNAYEVQHydrophilic
NLS Segment(s)
PositionSequence
101-113PEKKKKGRSQKSK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MTEQPQQQRQAPTSTRTVTQTVTTTAPPILRLAANREPRTEVTWDESVIDNEHLNRKKTKICCIYHPADEDGNRHCDSDSDSSSDSSDSSGDEPEKPNNNPEKKKKGRSQKSKPNAYEVQPTYRNRSHVPKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.41
4 0.4
5 0.33
6 0.32
7 0.29
8 0.25
9 0.25
10 0.22
11 0.2
12 0.2
13 0.19
14 0.16
15 0.15
16 0.14
17 0.13
18 0.14
19 0.2
20 0.26
21 0.35
22 0.36
23 0.37
24 0.38
25 0.38
26 0.4
27 0.35
28 0.28
29 0.24
30 0.23
31 0.22
32 0.2
33 0.19
34 0.17
35 0.16
36 0.15
37 0.1
38 0.11
39 0.19
40 0.21
41 0.22
42 0.24
43 0.26
44 0.32
45 0.35
46 0.43
47 0.44
48 0.43
49 0.47
50 0.51
51 0.52
52 0.48
53 0.46
54 0.38
55 0.31
56 0.3
57 0.25
58 0.21
59 0.22
60 0.19
61 0.18
62 0.16
63 0.14
64 0.17
65 0.2
66 0.19
67 0.17
68 0.18
69 0.18
70 0.18
71 0.18
72 0.14
73 0.1
74 0.09
75 0.07
76 0.07
77 0.09
78 0.1
79 0.12
80 0.14
81 0.2
82 0.25
83 0.25
84 0.33
85 0.41
86 0.49
87 0.56
88 0.64
89 0.69
90 0.74
91 0.83
92 0.84
93 0.86
94 0.88
95 0.89
96 0.91
97 0.91
98 0.91
99 0.92
100 0.85
101 0.82
102 0.77
103 0.7
104 0.69
105 0.61
106 0.59
107 0.57
108 0.57
109 0.57
110 0.56
111 0.56
112 0.52