Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367XRM1

Protein Details
Accession A0A367XRM1   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
96-126LQAQDFLKWRKKQLRRDNKEKIKNNNFMSKLHydrophilic
NLS Segment(s)
PositionSequence
106-111KKQLRR
Subcellular Location(s) mito 19.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRTISQLTPRRVGPIINTRCFSVASIIRNQAQQAAATKPATPTPEGAAPKSSCPAGTVLNLKVFKKGDEPVAKEDSEYPDWLWDMLDQKKVMDTLQAQDFLKWRKKQLRRDNKEKIKNNNFMSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.44
4 0.45
5 0.45
6 0.42
7 0.42
8 0.41
9 0.34
10 0.29
11 0.25
12 0.23
13 0.27
14 0.29
15 0.3
16 0.3
17 0.3
18 0.26
19 0.22
20 0.2
21 0.18
22 0.17
23 0.18
24 0.18
25 0.18
26 0.17
27 0.19
28 0.19
29 0.17
30 0.16
31 0.15
32 0.21
33 0.21
34 0.21
35 0.23
36 0.22
37 0.22
38 0.22
39 0.2
40 0.14
41 0.13
42 0.14
43 0.11
44 0.12
45 0.14
46 0.14
47 0.19
48 0.21
49 0.2
50 0.22
51 0.21
52 0.19
53 0.19
54 0.19
55 0.21
56 0.25
57 0.27
58 0.29
59 0.31
60 0.3
61 0.28
62 0.29
63 0.26
64 0.22
65 0.2
66 0.16
67 0.14
68 0.15
69 0.14
70 0.13
71 0.1
72 0.13
73 0.15
74 0.18
75 0.18
76 0.18
77 0.19
78 0.19
79 0.17
80 0.17
81 0.15
82 0.16
83 0.19
84 0.22
85 0.22
86 0.23
87 0.28
88 0.31
89 0.39
90 0.38
91 0.44
92 0.52
93 0.61
94 0.7
95 0.76
96 0.81
97 0.82
98 0.89
99 0.91
100 0.91
101 0.93
102 0.91
103 0.91
104 0.89
105 0.89
106 0.84