Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YF99

Protein Details
Accession A0A367YF99   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-118SNTVHALSVKRKRRKKMNKHKYKKRRKAQRALRKRLGKBasic
NLS Segment(s)
PositionSequence
90-118KRKRRKKMNKHKYKKRRKAQRALRKRLGK
Subcellular Location(s) mito 21, mito_nucl 13.333, cyto_mito 11.333, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFRSLVRFAPRIGVRTPVFSRFASSYTPSSFSTASPLTATTLRAHASPIMQELYANRLGGNEPFGLIREYNLDIVPGDEDSNTVHALSVKRKRRKKMNKHKYKKRRKAQRALRKRLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.4
4 0.35
5 0.36
6 0.32
7 0.35
8 0.29
9 0.3
10 0.26
11 0.26
12 0.26
13 0.24
14 0.27
15 0.24
16 0.25
17 0.24
18 0.2
19 0.22
20 0.19
21 0.17
22 0.15
23 0.14
24 0.14
25 0.14
26 0.15
27 0.12
28 0.13
29 0.13
30 0.12
31 0.13
32 0.12
33 0.11
34 0.1
35 0.11
36 0.1
37 0.09
38 0.09
39 0.08
40 0.11
41 0.11
42 0.11
43 0.09
44 0.09
45 0.09
46 0.09
47 0.11
48 0.07
49 0.06
50 0.06
51 0.07
52 0.08
53 0.07
54 0.07
55 0.08
56 0.09
57 0.09
58 0.09
59 0.09
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.05
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.07
72 0.09
73 0.12
74 0.21
75 0.3
76 0.39
77 0.48
78 0.57
79 0.66
80 0.74
81 0.83
82 0.86
83 0.88
84 0.9
85 0.92
86 0.95
87 0.97
88 0.97
89 0.97
90 0.97
91 0.96
92 0.96
93 0.96
94 0.95
95 0.95
96 0.96
97 0.95
98 0.95