Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8N5W6

Protein Details
Accession B8N5W6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-49QVPRPFRNPHWKPSQRRNKNVKQLISEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MAPPTPAENESHQLLLNQLDIAQVPRPFRNPHWKPSQRRNKNVKQLISESSRKEASQMATQANSGATTPLVATTSASTDGSQTPADGGQRTNIAQAAQNLSTLVLEKNARAMYSSGPAVTYTNIESAPSLHPSQQTRYCDITGLPAPYTDPKTRLRYHDKEVFGVVRSLAQGVPESYLELRAAHVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.16
4 0.12
5 0.1
6 0.1
7 0.1
8 0.11
9 0.14
10 0.16
11 0.18
12 0.21
13 0.26
14 0.3
15 0.37
16 0.46
17 0.48
18 0.53
19 0.61
20 0.68
21 0.73
22 0.79
23 0.83
24 0.83
25 0.88
26 0.9
27 0.89
28 0.9
29 0.89
30 0.83
31 0.78
32 0.71
33 0.66
34 0.62
35 0.57
36 0.49
37 0.44
38 0.4
39 0.34
40 0.32
41 0.29
42 0.25
43 0.25
44 0.26
45 0.24
46 0.23
47 0.23
48 0.22
49 0.19
50 0.16
51 0.11
52 0.08
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.07
62 0.07
63 0.08
64 0.07
65 0.08
66 0.09
67 0.1
68 0.09
69 0.08
70 0.08
71 0.08
72 0.09
73 0.09
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.1
83 0.11
84 0.1
85 0.1
86 0.1
87 0.09
88 0.09
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.1
95 0.1
96 0.1
97 0.11
98 0.11
99 0.1
100 0.12
101 0.13
102 0.09
103 0.1
104 0.1
105 0.1
106 0.09
107 0.09
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.09
114 0.11
115 0.13
116 0.13
117 0.14
118 0.19
119 0.21
120 0.27
121 0.32
122 0.34
123 0.35
124 0.38
125 0.36
126 0.33
127 0.3
128 0.29
129 0.26
130 0.24
131 0.2
132 0.16
133 0.18
134 0.21
135 0.27
136 0.24
137 0.25
138 0.3
139 0.37
140 0.43
141 0.5
142 0.55
143 0.56
144 0.62
145 0.66
146 0.61
147 0.56
148 0.55
149 0.48
150 0.4
151 0.35
152 0.26
153 0.19
154 0.17
155 0.17
156 0.13
157 0.12
158 0.12
159 0.11
160 0.13
161 0.12
162 0.14
163 0.13
164 0.15
165 0.14
166 0.13
167 0.13
168 0.13