Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YNZ7

Protein Details
Accession A0A367YNZ7    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-27LGLAKAAKAKKQKREGTSQGASHydrophilic
NLS Segment(s)
PositionSequence
10-19KAAKAKKQKR
Subcellular Location(s) nucl 13.5, cyto_nucl 10.666, cyto_mito 7.333, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024318  Nro1/ETT1  
Gene Ontology GO:0005634  C:nucleus  
GO:0006417  P:regulation of translation  
Pfam View protein in Pfam  
PF12753  Nro1  
Amino Acid Sequences MAKRTLGLAKAAKAKKQKREGTSQGASEEAGDNEEQLTVELPEGIDANDEVAQLEALYRKYMDSEKDNELLVNGIVHECDSLLRSAEDTKVTLPALFHSIYGRALAELAKCVPDDDEDKERKQKEYIDAALERIEIGFEKFPDDAHLLVAKAKILLAQLFYQHVSKVTPTSRKEDLDVDIENVLDSVLEVYASGETKAIEVKNFAVFKGPDATSFLEAFDDLLSLIALHGNEIPDEEDDFGDDEEDIVVNELAEDHPFFGIRNSDKYNIWWKDHLETFLDTLKKLDRKEVSDTLWRYINRKLGQCFLEEAERPSRVFTTLKYEDDFQGIEELEGLSLKEAETMAKELMTKALEYLQGAKDEEDPDTWVDLAEAMISMGNLQEMESKEQEELYDEAEDILRKANNATNGKYTDVLDNLLEIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.73
4 0.77
5 0.74
6 0.8
7 0.82
8 0.81
9 0.78
10 0.7
11 0.6
12 0.52
13 0.45
14 0.36
15 0.29
16 0.19
17 0.15
18 0.13
19 0.12
20 0.11
21 0.12
22 0.1
23 0.08
24 0.09
25 0.07
26 0.08
27 0.08
28 0.07
29 0.07
30 0.08
31 0.08
32 0.08
33 0.07
34 0.08
35 0.09
36 0.09
37 0.08
38 0.08
39 0.08
40 0.07
41 0.08
42 0.1
43 0.1
44 0.11
45 0.11
46 0.11
47 0.14
48 0.18
49 0.22
50 0.25
51 0.29
52 0.33
53 0.34
54 0.34
55 0.31
56 0.27
57 0.23
58 0.18
59 0.13
60 0.09
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.07
68 0.07
69 0.08
70 0.08
71 0.1
72 0.12
73 0.14
74 0.14
75 0.14
76 0.14
77 0.15
78 0.16
79 0.15
80 0.14
81 0.13
82 0.15
83 0.15
84 0.14
85 0.13
86 0.14
87 0.13
88 0.14
89 0.12
90 0.09
91 0.09
92 0.1
93 0.1
94 0.1
95 0.1
96 0.11
97 0.1
98 0.11
99 0.11
100 0.11
101 0.13
102 0.16
103 0.24
104 0.28
105 0.32
106 0.39
107 0.41
108 0.41
109 0.41
110 0.42
111 0.4
112 0.43
113 0.42
114 0.4
115 0.38
116 0.37
117 0.34
118 0.29
119 0.22
120 0.15
121 0.12
122 0.06
123 0.08
124 0.08
125 0.08
126 0.1
127 0.1
128 0.1
129 0.12
130 0.13
131 0.11
132 0.11
133 0.12
134 0.11
135 0.12
136 0.13
137 0.1
138 0.09
139 0.09
140 0.08
141 0.08
142 0.08
143 0.08
144 0.09
145 0.1
146 0.11
147 0.12
148 0.11
149 0.11
150 0.11
151 0.1
152 0.1
153 0.13
154 0.17
155 0.24
156 0.26
157 0.31
158 0.34
159 0.34
160 0.35
161 0.33
162 0.3
163 0.26
164 0.24
165 0.2
166 0.16
167 0.15
168 0.13
169 0.1
170 0.08
171 0.04
172 0.04
173 0.03
174 0.03
175 0.02
176 0.03
177 0.03
178 0.04
179 0.04
180 0.04
181 0.04
182 0.05
183 0.05
184 0.07
185 0.08
186 0.07
187 0.08
188 0.09
189 0.13
190 0.13
191 0.13
192 0.14
193 0.14
194 0.15
195 0.18
196 0.17
197 0.13
198 0.15
199 0.16
200 0.14
201 0.15
202 0.14
203 0.09
204 0.09
205 0.09
206 0.06
207 0.05
208 0.04
209 0.03
210 0.03
211 0.03
212 0.03
213 0.04
214 0.04
215 0.04
216 0.05
217 0.05
218 0.05
219 0.05
220 0.06
221 0.06
222 0.06
223 0.07
224 0.06
225 0.06
226 0.07
227 0.06
228 0.06
229 0.05
230 0.05
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.03
237 0.03
238 0.04
239 0.04
240 0.04
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.06
247 0.11
248 0.12
249 0.16
250 0.19
251 0.21
252 0.22
253 0.25
254 0.34
255 0.34
256 0.35
257 0.34
258 0.33
259 0.35
260 0.36
261 0.34
262 0.26
263 0.23
264 0.22
265 0.24
266 0.22
267 0.18
268 0.17
269 0.21
270 0.23
271 0.23
272 0.29
273 0.29
274 0.32
275 0.39
276 0.41
277 0.39
278 0.43
279 0.45
280 0.4
281 0.41
282 0.38
283 0.34
284 0.34
285 0.39
286 0.36
287 0.4
288 0.39
289 0.4
290 0.4
291 0.39
292 0.36
293 0.3
294 0.3
295 0.25
296 0.26
297 0.25
298 0.25
299 0.24
300 0.23
301 0.22
302 0.2
303 0.2
304 0.18
305 0.23
306 0.26
307 0.28
308 0.28
309 0.29
310 0.28
311 0.29
312 0.27
313 0.18
314 0.16
315 0.14
316 0.12
317 0.1
318 0.09
319 0.07
320 0.08
321 0.07
322 0.05
323 0.05
324 0.05
325 0.06
326 0.06
327 0.07
328 0.08
329 0.1
330 0.1
331 0.11
332 0.11
333 0.11
334 0.14
335 0.14
336 0.12
337 0.11
338 0.14
339 0.14
340 0.14
341 0.19
342 0.18
343 0.19
344 0.2
345 0.2
346 0.21
347 0.21
348 0.22
349 0.18
350 0.18
351 0.16
352 0.17
353 0.16
354 0.12
355 0.11
356 0.1
357 0.09
358 0.07
359 0.06
360 0.04
361 0.05
362 0.04
363 0.04
364 0.04
365 0.05
366 0.04
367 0.05
368 0.1
369 0.12
370 0.17
371 0.18
372 0.19
373 0.2
374 0.2
375 0.2
376 0.18
377 0.17
378 0.14
379 0.14
380 0.13
381 0.13
382 0.15
383 0.15
384 0.12
385 0.16
386 0.15
387 0.15
388 0.18
389 0.21
390 0.29
391 0.34
392 0.37
393 0.39
394 0.41
395 0.43
396 0.42
397 0.39
398 0.34
399 0.3
400 0.28
401 0.21