Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367XL39

Protein Details
Accession A0A367XL39   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
78-107RDKYTTFNRHWKNYRKPVHRVPKWTKLSFRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_mito 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLPSFVRLGGYLWKYNSRISAGQKASMRSRMKQVDENIKSIYEGLLAAQGKTPGELTGAKRIDYLQFEFPKESEMTPRDKYTTFNRHWKNYRKPVHRVPKWTKLSFREDPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.35
4 0.32
5 0.33
6 0.35
7 0.41
8 0.38
9 0.42
10 0.43
11 0.44
12 0.44
13 0.48
14 0.46
15 0.39
16 0.46
17 0.46
18 0.47
19 0.49
20 0.51
21 0.53
22 0.52
23 0.52
24 0.44
25 0.38
26 0.34
27 0.28
28 0.21
29 0.11
30 0.08
31 0.06
32 0.09
33 0.09
34 0.09
35 0.09
36 0.1
37 0.09
38 0.09
39 0.1
40 0.05
41 0.07
42 0.09
43 0.1
44 0.18
45 0.18
46 0.18
47 0.18
48 0.19
49 0.2
50 0.2
51 0.21
52 0.2
53 0.21
54 0.23
55 0.23
56 0.22
57 0.23
58 0.21
59 0.19
60 0.18
61 0.19
62 0.23
63 0.25
64 0.27
65 0.27
66 0.27
67 0.3
68 0.33
69 0.41
70 0.41
71 0.49
72 0.54
73 0.6
74 0.69
75 0.76
76 0.77
77 0.78
78 0.83
79 0.81
80 0.83
81 0.85
82 0.87
83 0.85
84 0.85
85 0.83
86 0.83
87 0.84
88 0.81
89 0.79
90 0.74
91 0.75
92 0.73
93 0.74