Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367XN67

Protein Details
Accession A0A367XN67    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-68RECFRRSSYKNWGPRQRPENDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, extr 7, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPINNQPISRAKPAAYTPWLGVGAILLAGGAYMLYNRTPRHEPGCNCRECFRRSSYKNWGPRQRPENDIIKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.32
4 0.27
5 0.27
6 0.27
7 0.22
8 0.19
9 0.12
10 0.09
11 0.07
12 0.06
13 0.03
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.03
21 0.04
22 0.06
23 0.07
24 0.11
25 0.14
26 0.17
27 0.23
28 0.29
29 0.32
30 0.39
31 0.47
32 0.47
33 0.47
34 0.5
35 0.5
36 0.46
37 0.47
38 0.45
39 0.47
40 0.47
41 0.54
42 0.59
43 0.62
44 0.69
45 0.75
46 0.79
47 0.75
48 0.81
49 0.81
50 0.75
51 0.72
52 0.68