Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367YMC9

Protein Details
Accession A0A367YMC9    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-26FDTTPKSITSPKRKKVGNKDTEDNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 11.5, mito 4.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR002717  HAT_MYST-type  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0004402  F:histone acetyltransferase activity  
GO:0016573  P:histone acetylation  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF01853  MOZ_SAS  
PROSITE View protein in PROSITE  
PS51726  MYST_HAT  
Amino Acid Sequences MFDTTPKSITSPKRKKVGNKDTEDNSYYGQLNKRNINKVTFGDYEFSAWYGNAAFFYPHDLSHSTLGYEYANKVALEGSGAKKIHKKDMFDENLHEFWLDHLYVCEYCFRYSSHEHELNSHVVKCRYNRWRPNIGTLVYKDNTNGYIIREVRGFQDPLFCQNLCLFGKLFLDDKSIYYNIEHFNFYIVYGKDETTPNYIPMGFFSKEVLSYENDINLACICVFPPFQRRHLGSLLIEFLYRLSKVTPGQYGGSGPEYPLSPYGKMTYLRFWSKRLAKTIHNMQGELTLNQLSKLTGFRKEDILLTLEFMEVLVQDDSTGSVSLSVENLKRWMKQNKFDPEMEIDALDPECLIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.82
3 0.85
4 0.85
5 0.84
6 0.82
7 0.81
8 0.78
9 0.77
10 0.69
11 0.59
12 0.5
13 0.43
14 0.36
15 0.34
16 0.34
17 0.34
18 0.38
19 0.45
20 0.5
21 0.55
22 0.58
23 0.57
24 0.56
25 0.53
26 0.53
27 0.47
28 0.41
29 0.35
30 0.31
31 0.28
32 0.24
33 0.21
34 0.15
35 0.12
36 0.11
37 0.09
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.14
44 0.14
45 0.13
46 0.16
47 0.17
48 0.19
49 0.21
50 0.21
51 0.16
52 0.15
53 0.16
54 0.14
55 0.15
56 0.13
57 0.12
58 0.14
59 0.13
60 0.13
61 0.12
62 0.11
63 0.11
64 0.13
65 0.14
66 0.18
67 0.19
68 0.21
69 0.27
70 0.3
71 0.38
72 0.39
73 0.4
74 0.4
75 0.5
76 0.54
77 0.5
78 0.52
79 0.46
80 0.42
81 0.39
82 0.33
83 0.22
84 0.17
85 0.18
86 0.13
87 0.09
88 0.09
89 0.11
90 0.11
91 0.11
92 0.15
93 0.13
94 0.14
95 0.15
96 0.15
97 0.19
98 0.22
99 0.27
100 0.31
101 0.34
102 0.33
103 0.35
104 0.37
105 0.36
106 0.35
107 0.32
108 0.27
109 0.25
110 0.28
111 0.28
112 0.34
113 0.41
114 0.49
115 0.55
116 0.59
117 0.67
118 0.65
119 0.7
120 0.66
121 0.57
122 0.51
123 0.44
124 0.43
125 0.33
126 0.31
127 0.24
128 0.2
129 0.19
130 0.16
131 0.15
132 0.1
133 0.15
134 0.16
135 0.16
136 0.16
137 0.16
138 0.17
139 0.19
140 0.18
141 0.13
142 0.18
143 0.18
144 0.21
145 0.23
146 0.2
147 0.18
148 0.18
149 0.22
150 0.17
151 0.17
152 0.14
153 0.13
154 0.13
155 0.13
156 0.14
157 0.09
158 0.12
159 0.11
160 0.11
161 0.12
162 0.12
163 0.12
164 0.11
165 0.13
166 0.13
167 0.14
168 0.14
169 0.11
170 0.12
171 0.11
172 0.11
173 0.13
174 0.11
175 0.12
176 0.12
177 0.13
178 0.14
179 0.15
180 0.16
181 0.16
182 0.16
183 0.15
184 0.15
185 0.15
186 0.13
187 0.14
188 0.17
189 0.13
190 0.13
191 0.13
192 0.12
193 0.13
194 0.13
195 0.13
196 0.1
197 0.12
198 0.12
199 0.12
200 0.12
201 0.11
202 0.11
203 0.09
204 0.08
205 0.05
206 0.05
207 0.05
208 0.06
209 0.07
210 0.09
211 0.17
212 0.2
213 0.23
214 0.3
215 0.32
216 0.34
217 0.36
218 0.37
219 0.29
220 0.28
221 0.26
222 0.2
223 0.18
224 0.13
225 0.12
226 0.1
227 0.1
228 0.08
229 0.07
230 0.1
231 0.12
232 0.15
233 0.17
234 0.17
235 0.18
236 0.18
237 0.19
238 0.17
239 0.18
240 0.15
241 0.13
242 0.12
243 0.12
244 0.12
245 0.15
246 0.15
247 0.13
248 0.15
249 0.17
250 0.19
251 0.21
252 0.22
253 0.25
254 0.29
255 0.37
256 0.38
257 0.38
258 0.44
259 0.49
260 0.53
261 0.55
262 0.53
263 0.49
264 0.56
265 0.63
266 0.63
267 0.56
268 0.51
269 0.43
270 0.45
271 0.42
272 0.33
273 0.25
274 0.19
275 0.17
276 0.17
277 0.17
278 0.12
279 0.11
280 0.16
281 0.18
282 0.23
283 0.26
284 0.28
285 0.31
286 0.32
287 0.32
288 0.29
289 0.29
290 0.21
291 0.19
292 0.18
293 0.14
294 0.12
295 0.1
296 0.09
297 0.06
298 0.08
299 0.07
300 0.06
301 0.06
302 0.07
303 0.07
304 0.08
305 0.08
306 0.06
307 0.07
308 0.08
309 0.08
310 0.1
311 0.14
312 0.14
313 0.16
314 0.22
315 0.24
316 0.29
317 0.37
318 0.47
319 0.51
320 0.59
321 0.67
322 0.71
323 0.74
324 0.7
325 0.66
326 0.61
327 0.56
328 0.48
329 0.38
330 0.28
331 0.24
332 0.23
333 0.18