Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367YS14

Protein Details
Accession A0A367YS14    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-38RDLKPVFKPHHPNPKNTPKSFHydrophilic
79-111DEKVARQRKYRDMKMQHEKERRVREREERERARBasic
NLS Segment(s)
PositionSequence
72-120PEQRKALDEKVARQRKYRDMKMQHEKERRVREREERERARDLARALRAP
Subcellular Location(s) mito 15, mito_nucl 12.666, cyto_mito 9.666, nucl 9, cyto_nucl 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR029028  Alpha/beta_knot_MTases  
IPR029064  L30e-like  
IPR047182  MRM1  
IPR047261  MRM1_MeTrfase_dom  
IPR004441  rRNA_MeTrfase_TrmH  
IPR001537  SpoU_MeTrfase  
IPR013123  SpoU_subst-bd  
IPR029026  tRNA_m1G_MTases_N  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003723  F:RNA binding  
GO:0008173  F:RNA methyltransferase activity  
GO:0031167  P:rRNA methylation  
Pfam View protein in Pfam  
PF00588  SpoU_methylase  
PF08032  SpoU_sub_bind  
CDD cd18105  SpoU-like_MRM1  
Amino Acid Sequences MLSQKRSFSVLSTLLKSRDLKPVFKPHHPNPKNTPKSFTKSLPQSKNEAKPWEKKNLSKDEFFMRKYGNIKPEQRKALDEKVARQRKYRDMKMQHEKERRVREREERERARDLARALRAPSRRDSDSSEGGLFGRTTTIFDYIFGTHAVKAALTSGKRRVLELYTYNNSDREIVRLAEEKYGLEPREVRDKHALNLLCKNGVHNGVVLKTRKLDVNYIQELGHAEEGSYQLSIENDEDGSVEKMTKPVIREAKEGEAKPFPLVLFVDGVTDPQNMGNILRSAFFFGVDAVIVPEDNSAKLGPVAFKASAGALDLIDLYATDSSLKFITLVRNNGWFVVSTSGRPDESSSDKEQRFADKFIELEALQTVLRKAPVMLVIGSEGEGVRTNIKMASDYLVAIDKYRSDDTIVDSLNVGVATGVILQSCVGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.44
4 0.41
5 0.44
6 0.44
7 0.45
8 0.49
9 0.58
10 0.6
11 0.66
12 0.72
13 0.71
14 0.78
15 0.77
16 0.77
17 0.77
18 0.81
19 0.82
20 0.76
21 0.74
22 0.71
23 0.74
24 0.73
25 0.67
26 0.66
27 0.66
28 0.73
29 0.75
30 0.7
31 0.7
32 0.72
33 0.76
34 0.73
35 0.72
36 0.69
37 0.7
38 0.72
39 0.74
40 0.72
41 0.7
42 0.73
43 0.74
44 0.72
45 0.66
46 0.63
47 0.62
48 0.62
49 0.56
50 0.51
51 0.42
52 0.42
53 0.42
54 0.46
55 0.44
56 0.46
57 0.55
58 0.6
59 0.66
60 0.69
61 0.67
62 0.66
63 0.64
64 0.63
65 0.62
66 0.56
67 0.56
68 0.6
69 0.66
70 0.63
71 0.64
72 0.62
73 0.64
74 0.7
75 0.7
76 0.7
77 0.71
78 0.79
79 0.83
80 0.85
81 0.85
82 0.85
83 0.84
84 0.83
85 0.84
86 0.82
87 0.78
88 0.76
89 0.76
90 0.78
91 0.8
92 0.82
93 0.78
94 0.76
95 0.74
96 0.69
97 0.62
98 0.54
99 0.47
100 0.43
101 0.39
102 0.36
103 0.33
104 0.38
105 0.4
106 0.39
107 0.42
108 0.4
109 0.39
110 0.39
111 0.42
112 0.41
113 0.4
114 0.39
115 0.33
116 0.28
117 0.25
118 0.24
119 0.17
120 0.12
121 0.09
122 0.07
123 0.08
124 0.09
125 0.1
126 0.09
127 0.1
128 0.12
129 0.11
130 0.12
131 0.12
132 0.12
133 0.1
134 0.11
135 0.1
136 0.08
137 0.07
138 0.09
139 0.12
140 0.12
141 0.16
142 0.2
143 0.25
144 0.25
145 0.26
146 0.27
147 0.25
148 0.29
149 0.29
150 0.3
151 0.28
152 0.31
153 0.31
154 0.29
155 0.27
156 0.24
157 0.2
158 0.16
159 0.15
160 0.12
161 0.13
162 0.16
163 0.17
164 0.17
165 0.17
166 0.15
167 0.15
168 0.18
169 0.17
170 0.15
171 0.15
172 0.15
173 0.26
174 0.26
175 0.27
176 0.31
177 0.32
178 0.32
179 0.36
180 0.37
181 0.29
182 0.34
183 0.31
184 0.25
185 0.24
186 0.23
187 0.19
188 0.18
189 0.16
190 0.12
191 0.12
192 0.12
193 0.17
194 0.17
195 0.15
196 0.15
197 0.16
198 0.17
199 0.17
200 0.19
201 0.19
202 0.25
203 0.26
204 0.26
205 0.25
206 0.23
207 0.22
208 0.2
209 0.15
210 0.08
211 0.07
212 0.06
213 0.07
214 0.07
215 0.06
216 0.05
217 0.05
218 0.05
219 0.06
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.06
226 0.07
227 0.06
228 0.06
229 0.06
230 0.07
231 0.09
232 0.1
233 0.11
234 0.17
235 0.24
236 0.26
237 0.28
238 0.3
239 0.35
240 0.39
241 0.38
242 0.34
243 0.29
244 0.28
245 0.26
246 0.25
247 0.18
248 0.14
249 0.13
250 0.11
251 0.09
252 0.08
253 0.09
254 0.08
255 0.09
256 0.08
257 0.08
258 0.08
259 0.07
260 0.08
261 0.07
262 0.07
263 0.08
264 0.08
265 0.09
266 0.09
267 0.09
268 0.11
269 0.11
270 0.1
271 0.08
272 0.07
273 0.07
274 0.06
275 0.06
276 0.04
277 0.04
278 0.04
279 0.04
280 0.05
281 0.05
282 0.06
283 0.06
284 0.06
285 0.06
286 0.07
287 0.08
288 0.08
289 0.09
290 0.12
291 0.11
292 0.11
293 0.12
294 0.11
295 0.1
296 0.1
297 0.09
298 0.06
299 0.06
300 0.06
301 0.05
302 0.05
303 0.05
304 0.04
305 0.04
306 0.04
307 0.05
308 0.05
309 0.07
310 0.07
311 0.07
312 0.07
313 0.09
314 0.17
315 0.22
316 0.26
317 0.27
318 0.31
319 0.31
320 0.31
321 0.29
322 0.22
323 0.18
324 0.19
325 0.18
326 0.15
327 0.18
328 0.19
329 0.19
330 0.19
331 0.2
332 0.19
333 0.24
334 0.28
335 0.31
336 0.39
337 0.39
338 0.42
339 0.42
340 0.46
341 0.44
342 0.41
343 0.37
344 0.3
345 0.29
346 0.27
347 0.28
348 0.2
349 0.17
350 0.15
351 0.14
352 0.12
353 0.13
354 0.12
355 0.11
356 0.12
357 0.12
358 0.11
359 0.13
360 0.15
361 0.16
362 0.15
363 0.14
364 0.14
365 0.14
366 0.14
367 0.12
368 0.09
369 0.08
370 0.09
371 0.09
372 0.1
373 0.1
374 0.11
375 0.12
376 0.13
377 0.14
378 0.13
379 0.16
380 0.15
381 0.15
382 0.15
383 0.17
384 0.17
385 0.17
386 0.17
387 0.15
388 0.19
389 0.2
390 0.2
391 0.19
392 0.2
393 0.24
394 0.29
395 0.28
396 0.24
397 0.23
398 0.22
399 0.21
400 0.19
401 0.14
402 0.07
403 0.06
404 0.06
405 0.06
406 0.06
407 0.05
408 0.05