Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367YI22

Protein Details
Accession A0A367YI22    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-91TTSTVWKMRRRTFRNGSCWRYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, nucl 11, cyto 10, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Pfam View protein in Pfam  
PF00018  SH3_1  
PROSITE View protein in PROSITE  
PS50002  SH3  
Amino Acid Sequences MSTPDEINCKARAIFDFSAENDNEISLVEGQIIWISYRHGQGWLVAEDPENGENGLVPEDTSRLSVSWKTTTSTVWKMRRRTFRNGSCWRYLAMREMNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.26
4 0.25
5 0.3
6 0.27
7 0.25
8 0.18
9 0.17
10 0.14
11 0.11
12 0.11
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.06
20 0.05
21 0.05
22 0.06
23 0.08
24 0.1
25 0.1
26 0.11
27 0.11
28 0.12
29 0.14
30 0.13
31 0.12
32 0.11
33 0.1
34 0.1
35 0.1
36 0.09
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.05
47 0.06
48 0.07
49 0.07
50 0.06
51 0.08
52 0.1
53 0.13
54 0.16
55 0.17
56 0.18
57 0.18
58 0.21
59 0.25
60 0.31
61 0.37
62 0.43
63 0.49
64 0.56
65 0.65
66 0.73
67 0.73
68 0.75
69 0.77
70 0.77
71 0.81
72 0.82
73 0.8
74 0.75
75 0.7
76 0.61
77 0.54
78 0.47
79 0.44