Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YKC1

Protein Details
Accession A0A367YKC1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
171-199LVMKKRLKSTTTMRKRKKRKLTRSNLKRCHydrophilic
NLS Segment(s)
PositionSequence
175-194KRLKSTTTMRKRKKRKLTRS
Subcellular Location(s) nucl 21.5, cyto_nucl 13.833, mito_nucl 11.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR007149  Leo1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0016570  P:histone modification  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF04004  Leo1  
Amino Acid Sequences MNRWRYHNAGNDDIAKQSNAHFVAWNDGSVSLKVGNEIYDVRELPLFDHLLVRSYEDAEILQSDSIISKTMNLLPATSAHRKILVKNITKKEKILNTITDVDPLEKQRIADENVRKAMKLKRQLESKRRLQDEKWERSASPGFKPQGTSYQSYSRSMRMTMMAMVETISLLVMKKRLKSTTTMRKRKKRKLTRSNLKRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.29
3 0.23
4 0.2
5 0.23
6 0.2
7 0.2
8 0.21
9 0.2
10 0.26
11 0.26
12 0.24
13 0.18
14 0.18
15 0.18
16 0.16
17 0.17
18 0.11
19 0.1
20 0.11
21 0.11
22 0.1
23 0.1
24 0.11
25 0.12
26 0.13
27 0.14
28 0.13
29 0.14
30 0.14
31 0.13
32 0.16
33 0.15
34 0.12
35 0.15
36 0.14
37 0.15
38 0.15
39 0.15
40 0.13
41 0.13
42 0.13
43 0.1
44 0.1
45 0.08
46 0.09
47 0.08
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.07
57 0.09
58 0.12
59 0.12
60 0.12
61 0.12
62 0.14
63 0.19
64 0.21
65 0.21
66 0.18
67 0.22
68 0.23
69 0.24
70 0.3
71 0.33
72 0.37
73 0.44
74 0.52
75 0.55
76 0.55
77 0.55
78 0.52
79 0.48
80 0.45
81 0.4
82 0.33
83 0.29
84 0.31
85 0.3
86 0.25
87 0.22
88 0.18
89 0.16
90 0.16
91 0.14
92 0.12
93 0.12
94 0.12
95 0.14
96 0.16
97 0.22
98 0.26
99 0.28
100 0.33
101 0.33
102 0.32
103 0.33
104 0.37
105 0.37
106 0.42
107 0.43
108 0.44
109 0.54
110 0.63
111 0.69
112 0.71
113 0.72
114 0.71
115 0.71
116 0.68
117 0.6
118 0.62
119 0.62
120 0.62
121 0.59
122 0.52
123 0.47
124 0.48
125 0.52
126 0.44
127 0.39
128 0.38
129 0.34
130 0.34
131 0.36
132 0.33
133 0.35
134 0.36
135 0.34
136 0.31
137 0.37
138 0.38
139 0.39
140 0.4
141 0.35
142 0.33
143 0.31
144 0.28
145 0.22
146 0.21
147 0.18
148 0.18
149 0.14
150 0.12
151 0.11
152 0.1
153 0.08
154 0.06
155 0.05
156 0.04
157 0.05
158 0.07
159 0.12
160 0.16
161 0.21
162 0.27
163 0.31
164 0.33
165 0.4
166 0.49
167 0.54
168 0.62
169 0.68
170 0.73
171 0.8
172 0.89
173 0.93
174 0.94
175 0.94
176 0.94
177 0.94
178 0.95
179 0.96