Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YBS9

Protein Details
Accession A0A367YBS9   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-124HADGAKKKTKRKLTKAQKANKLIQHydrophilic
NLS Segment(s)
PositionSequence
105-118AKKKTKRKLTKAQK
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
Amino Acid Sequences MGEAAYKFDEIKSQIPTNLEQVAEYVNLLKSKIPTTYAEFQPHIDYVKSIKPEDVVDDFKNLKISPITVSVTLVVLTTLFIFGKLLGGGSGSGNDSNIKLHADGAKKKTKRKLTKAQKANKLIQEILDYVELEYVPEIDKFIETYKTLSPEDTEYKFKYFDEMLLKELMKLDAIDVTGNEILRDNRRKVIKFIQDHQKRLDKFKREIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.33
4 0.32
5 0.32
6 0.28
7 0.22
8 0.19
9 0.18
10 0.15
11 0.14
12 0.12
13 0.12
14 0.12
15 0.13
16 0.14
17 0.15
18 0.17
19 0.18
20 0.19
21 0.2
22 0.26
23 0.33
24 0.36
25 0.39
26 0.38
27 0.37
28 0.37
29 0.35
30 0.3
31 0.23
32 0.19
33 0.17
34 0.21
35 0.23
36 0.21
37 0.21
38 0.2
39 0.21
40 0.23
41 0.24
42 0.23
43 0.21
44 0.24
45 0.24
46 0.24
47 0.25
48 0.21
49 0.19
50 0.15
51 0.15
52 0.13
53 0.16
54 0.16
55 0.14
56 0.15
57 0.13
58 0.13
59 0.12
60 0.1
61 0.06
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.04
72 0.04
73 0.03
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.07
88 0.11
89 0.15
90 0.2
91 0.25
92 0.33
93 0.36
94 0.43
95 0.5
96 0.56
97 0.61
98 0.66
99 0.72
100 0.75
101 0.81
102 0.85
103 0.86
104 0.85
105 0.81
106 0.77
107 0.7
108 0.62
109 0.52
110 0.43
111 0.35
112 0.26
113 0.21
114 0.16
115 0.12
116 0.09
117 0.09
118 0.08
119 0.06
120 0.06
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.06
128 0.08
129 0.1
130 0.1
131 0.12
132 0.14
133 0.17
134 0.18
135 0.17
136 0.17
137 0.2
138 0.24
139 0.25
140 0.28
141 0.26
142 0.28
143 0.28
144 0.26
145 0.26
146 0.21
147 0.23
148 0.25
149 0.24
150 0.24
151 0.26
152 0.26
153 0.24
154 0.24
155 0.2
156 0.13
157 0.12
158 0.11
159 0.09
160 0.09
161 0.09
162 0.07
163 0.1
164 0.11
165 0.11
166 0.11
167 0.12
168 0.15
169 0.24
170 0.31
171 0.31
172 0.37
173 0.45
174 0.47
175 0.52
176 0.59
177 0.6
178 0.6
179 0.66
180 0.7
181 0.71
182 0.72
183 0.74
184 0.73
185 0.66
186 0.7
187 0.7
188 0.68
189 0.69