Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YED0

Protein Details
Accession A0A367YED0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-31VNIPKTRRTFCKGKECRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTFCKGKECRKHTQHKVTQYKAGKASLYAQGKRRYDRKQSGYGGQTKQVFHKKAKTTKKVMLKLECIVCKSKTQMALKRCKHFELGGERKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.82
4 0.85
5 0.86
6 0.88
7 0.87
8 0.87
9 0.84
10 0.84
11 0.87
12 0.81
13 0.8
14 0.74
15 0.69
16 0.61
17 0.55
18 0.44
19 0.35
20 0.34
21 0.33
22 0.34
23 0.32
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.52
30 0.56
31 0.61
32 0.61
33 0.61
34 0.61
35 0.61
36 0.59
37 0.58
38 0.49
39 0.44
40 0.4
41 0.33
42 0.36
43 0.37
44 0.36
45 0.32
46 0.4
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.66
53 0.72
54 0.71
55 0.7
56 0.66
57 0.59
58 0.56
59 0.55
60 0.49
61 0.42
62 0.38
63 0.33
64 0.3
65 0.29
66 0.29
67 0.31
68 0.38
69 0.43
70 0.48
71 0.58
72 0.63
73 0.69
74 0.68
75 0.63
76 0.59
77 0.53
78 0.52
79 0.52
80 0.54
81 0.53
82 0.58
83 0.57
84 0.56
85 0.58
86 0.55