Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N9L8

Protein Details
Accession B8N9L8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRLHRTRPFTQRRIRQGTNSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 6, mito_nucl 6, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRLHRTRPFTQRRIRQGTNSKCAHTGPPQPRPVGNYCPDHLVGRAATTIYDHEDGLWWPLGVGSACIGACLIVAYRRSSHTSEGWSPVPDAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.8
4 0.79
5 0.78
6 0.72
7 0.63
8 0.56
9 0.53
10 0.47
11 0.43
12 0.44
13 0.43
14 0.48
15 0.51
16 0.51
17 0.5
18 0.5
19 0.48
20 0.45
21 0.41
22 0.36
23 0.32
24 0.33
25 0.33
26 0.29
27 0.24
28 0.19
29 0.14
30 0.11
31 0.1
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.08
39 0.07
40 0.08
41 0.08
42 0.1
43 0.09
44 0.07
45 0.06
46 0.06
47 0.07
48 0.06
49 0.06
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.07
60 0.09
61 0.11
62 0.13
63 0.17
64 0.21
65 0.23
66 0.27
67 0.27
68 0.33
69 0.35
70 0.38
71 0.37
72 0.35