Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367Y0E5

Protein Details
Accession A0A367Y0E5    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
39-59VENVRKRKPDLTKKYLKLHPEBasic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 10, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Gene Ontology GO:0000123  C:histone acetyltransferase complex  
Amino Acid Sequences MTSSKEPTILKIVGHRDFGPGGYYFEVEFEGSKTGWMSVENVRKRKPDLTKKYLKLHPEVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.28
4 0.28
5 0.27
6 0.22
7 0.16
8 0.15
9 0.13
10 0.13
11 0.1
12 0.1
13 0.1
14 0.08
15 0.08
16 0.06
17 0.07
18 0.06
19 0.07
20 0.06
21 0.06
22 0.06
23 0.07
24 0.08
25 0.14
26 0.23
27 0.3
28 0.35
29 0.39
30 0.42
31 0.46
32 0.52
33 0.56
34 0.58
35 0.62
36 0.66
37 0.73
38 0.78
39 0.83
40 0.81
41 0.76