Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7TRP4

Protein Details
Accession A7TRP4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-125LAEKVEKASRQQRKQKKNRDKKIFGTGKRLHydrophilic
NLS Segment(s)
PositionSequence
102-133KASRQQRKQKKNRDKKIFGTGKRLAKKTARRN
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vpo:Kpol_411p11  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDAITIRTRKVITNPLLSRKQFVIDVLHPNRANVSKDELREKLAEIYKAEKDAVSVFGFRTQFGGSKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVEKASRQQRKQKKNRDKKIFGTGKRLAKKTARRNAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.55
4 0.62
5 0.6
6 0.57
7 0.49
8 0.45
9 0.36
10 0.32
11 0.3
12 0.26
13 0.35
14 0.34
15 0.4
16 0.38
17 0.37
18 0.39
19 0.36
20 0.34
21 0.26
22 0.31
23 0.28
24 0.31
25 0.36
26 0.34
27 0.33
28 0.31
29 0.31
30 0.29
31 0.28
32 0.27
33 0.22
34 0.25
35 0.23
36 0.24
37 0.23
38 0.16
39 0.14
40 0.13
41 0.14
42 0.11
43 0.1
44 0.09
45 0.13
46 0.14
47 0.13
48 0.13
49 0.11
50 0.12
51 0.13
52 0.15
53 0.11
54 0.12
55 0.12
56 0.11
57 0.11
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.08
66 0.08
67 0.08
68 0.09
69 0.08
70 0.12
71 0.13
72 0.13
73 0.15
74 0.19
75 0.26
76 0.26
77 0.28
78 0.24
79 0.26
80 0.26
81 0.27
82 0.24
83 0.21
84 0.19
85 0.18
86 0.22
87 0.23
88 0.22
89 0.26
90 0.34
91 0.41
92 0.5
93 0.6
94 0.66
95 0.75
96 0.84
97 0.89
98 0.91
99 0.92
100 0.94
101 0.94
102 0.92
103 0.88
104 0.88
105 0.87
106 0.8
107 0.79
108 0.76
109 0.74
110 0.74
111 0.7
112 0.66
113 0.66
114 0.71
115 0.72