Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YJD8

Protein Details
Accession A0A367YJD8   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
106-126RGRGGFRGKRGGRRRGRGRPFBasic
NLS Segment(s)
PositionSequence
89-126KIKGKGAGPGAKPESNGRGRGGFRGKRGGRRRGRGRPF
Subcellular Location(s) mito 13.5, nucl 9.5, cyto_mito 9.333, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0120114  C:Sm-like protein family complex  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
PS52002  SM  
Amino Acid Sequences MKLVRFLMNIPNSTNQPVTVELKNGNIISGTMLSCNPLMNLNLKNVKLQQPLQDPILLEFINIRGNQVRQIILPDELNIESVLAKSETKIKGKGAGPGAKPESNGRGRGGFRGKRGGRRRGRGRPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.26
3 0.23
4 0.24
5 0.26
6 0.23
7 0.24
8 0.22
9 0.22
10 0.25
11 0.23
12 0.19
13 0.15
14 0.14
15 0.12
16 0.12
17 0.1
18 0.08
19 0.08
20 0.09
21 0.09
22 0.09
23 0.08
24 0.09
25 0.09
26 0.12
27 0.14
28 0.18
29 0.22
30 0.22
31 0.24
32 0.26
33 0.3
34 0.31
35 0.31
36 0.32
37 0.33
38 0.35
39 0.34
40 0.32
41 0.26
42 0.23
43 0.23
44 0.16
45 0.11
46 0.09
47 0.09
48 0.11
49 0.1
50 0.1
51 0.09
52 0.1
53 0.12
54 0.13
55 0.13
56 0.1
57 0.12
58 0.13
59 0.12
60 0.12
61 0.1
62 0.1
63 0.1
64 0.1
65 0.08
66 0.07
67 0.06
68 0.06
69 0.07
70 0.06
71 0.06
72 0.06
73 0.14
74 0.18
75 0.21
76 0.23
77 0.23
78 0.3
79 0.31
80 0.37
81 0.37
82 0.4
83 0.38
84 0.43
85 0.47
86 0.4
87 0.4
88 0.38
89 0.38
90 0.36
91 0.38
92 0.33
93 0.34
94 0.34
95 0.4
96 0.47
97 0.44
98 0.44
99 0.52
100 0.56
101 0.61
102 0.69
103 0.72
104 0.72
105 0.78
106 0.84