Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YB90

Protein Details
Accession A0A367YB90   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-113KHEKHEKHEKHVEKKHEKKHETNPPRALREPKTPKKHRRSDYPTPPSSBasic
NLS Segment(s)
PositionSequence
62-104KKEEKHEKHEKHEKHVEKKHEKKHETNPPRALREPKTPKKHRR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSGLVSKWATDESLVQEALKQDSKSQDHKKNNSLEDSKWNKPITSKGSEPLVSKWANVEEEKKEEKHEKHEKHEKHVEKKHEKKHETNPPRALREPKTPKKHRRSDYPTPPSSAENIDLTNPLAQRLDMLNLGKEAGESKGSGRHERERNRSADRERNLRSRDSHRSDRDGHTYSDRQKPRRDLEPIRDTRQHSHRDNHRTRDRDSHGHRRTTSHDKQNDKLKQEPDARQKEQEEQKTQELLKQIEQWESQDIDWAEME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.19
4 0.21
5 0.24
6 0.26
7 0.22
8 0.23
9 0.31
10 0.37
11 0.45
12 0.53
13 0.59
14 0.64
15 0.72
16 0.76
17 0.76
18 0.76
19 0.75
20 0.68
21 0.62
22 0.62
23 0.61
24 0.58
25 0.57
26 0.53
27 0.45
28 0.44
29 0.49
30 0.45
31 0.45
32 0.42
33 0.39
34 0.43
35 0.44
36 0.43
37 0.37
38 0.37
39 0.3
40 0.28
41 0.26
42 0.24
43 0.24
44 0.24
45 0.26
46 0.23
47 0.29
48 0.33
49 0.32
50 0.35
51 0.4
52 0.42
53 0.47
54 0.54
55 0.54
56 0.6
57 0.7
58 0.68
59 0.69
60 0.75
61 0.74
62 0.73
63 0.75
64 0.76
65 0.76
66 0.82
67 0.82
68 0.83
69 0.8
70 0.78
71 0.8
72 0.81
73 0.78
74 0.78
75 0.78
76 0.74
77 0.72
78 0.7
79 0.66
80 0.6
81 0.62
82 0.64
83 0.64
84 0.69
85 0.74
86 0.8
87 0.83
88 0.89
89 0.84
90 0.84
91 0.84
92 0.84
93 0.84
94 0.83
95 0.74
96 0.67
97 0.62
98 0.52
99 0.44
100 0.35
101 0.25
102 0.17
103 0.15
104 0.13
105 0.12
106 0.11
107 0.12
108 0.1
109 0.09
110 0.08
111 0.08
112 0.08
113 0.08
114 0.09
115 0.08
116 0.09
117 0.08
118 0.08
119 0.09
120 0.07
121 0.07
122 0.06
123 0.05
124 0.06
125 0.06
126 0.06
127 0.11
128 0.13
129 0.17
130 0.2
131 0.28
132 0.35
133 0.43
134 0.51
135 0.52
136 0.56
137 0.57
138 0.6
139 0.59
140 0.59
141 0.56
142 0.56
143 0.55
144 0.58
145 0.55
146 0.52
147 0.51
148 0.5
149 0.55
150 0.54
151 0.59
152 0.55
153 0.57
154 0.59
155 0.58
156 0.57
157 0.49
158 0.44
159 0.41
160 0.42
161 0.43
162 0.48
163 0.51
164 0.5
165 0.55
166 0.61
167 0.6
168 0.62
169 0.65
170 0.63
171 0.66
172 0.71
173 0.69
174 0.68
175 0.68
176 0.63
177 0.63
178 0.63
179 0.61
180 0.56
181 0.6
182 0.63
183 0.68
184 0.73
185 0.75
186 0.77
187 0.73
188 0.71
189 0.72
190 0.69
191 0.68
192 0.68
193 0.69
194 0.67
195 0.71
196 0.69
197 0.63
198 0.63
199 0.63
200 0.64
201 0.63
202 0.64
203 0.62
204 0.67
205 0.73
206 0.74
207 0.69
208 0.67
209 0.6
210 0.6
211 0.63
212 0.66
213 0.66
214 0.68
215 0.67
216 0.66
217 0.66
218 0.67
219 0.68
220 0.68
221 0.64
222 0.6
223 0.61
224 0.6
225 0.58
226 0.52
227 0.48
228 0.42
229 0.39
230 0.4
231 0.37
232 0.37
233 0.37
234 0.36
235 0.34
236 0.33
237 0.28
238 0.29
239 0.27