Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YNX8

Protein Details
Accession A0A367YNX8   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-46QFYSTKPPIPKLRKKIREKTEEKAQEHydrophilic
82-106PEYLKRERTFRKKHGNTPWNPKRKLBasic
NLS Segment(s)
PositionSequence
30-38PKLRKKIRE
86-106KRERTFRKKHGNTPWNPKRKL
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MFRLLARPQQLPRTPLFIIPQFYSTKPPIPKLRKKIREKTEEKAQEMAQEKPTALPDQPISFEQIRKSMIKNDKKHHPNDQPEYLKRERTFRKKHGNTPWNPKRKLSRDDMAKLRHLKEIFPHYRTIDLSRLFHISPEAVRRILKSKFERD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.42
4 0.36
5 0.35
6 0.32
7 0.33
8 0.3
9 0.3
10 0.33
11 0.3
12 0.34
13 0.34
14 0.4
15 0.47
16 0.55
17 0.64
18 0.69
19 0.77
20 0.8
21 0.86
22 0.89
23 0.88
24 0.89
25 0.84
26 0.81
27 0.81
28 0.77
29 0.69
30 0.62
31 0.52
32 0.48
33 0.45
34 0.4
35 0.32
36 0.26
37 0.24
38 0.22
39 0.23
40 0.18
41 0.16
42 0.15
43 0.14
44 0.14
45 0.16
46 0.15
47 0.17
48 0.17
49 0.19
50 0.17
51 0.18
52 0.2
53 0.19
54 0.2
55 0.24
56 0.32
57 0.4
58 0.46
59 0.5
60 0.57
61 0.62
62 0.65
63 0.66
64 0.65
65 0.64
66 0.63
67 0.65
68 0.62
69 0.58
70 0.61
71 0.54
72 0.52
73 0.45
74 0.47
75 0.48
76 0.52
77 0.59
78 0.61
79 0.7
80 0.7
81 0.78
82 0.81
83 0.82
84 0.79
85 0.81
86 0.82
87 0.8
88 0.76
89 0.72
90 0.71
91 0.69
92 0.68
93 0.64
94 0.62
95 0.61
96 0.66
97 0.68
98 0.62
99 0.62
100 0.61
101 0.55
102 0.54
103 0.45
104 0.39
105 0.39
106 0.45
107 0.45
108 0.41
109 0.43
110 0.38
111 0.41
112 0.42
113 0.39
114 0.35
115 0.32
116 0.32
117 0.3
118 0.32
119 0.29
120 0.28
121 0.26
122 0.21
123 0.21
124 0.25
125 0.26
126 0.25
127 0.26
128 0.29
129 0.34
130 0.38
131 0.44