Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367XV22

Protein Details
Accession A0A367XV22    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
75-94YLKYLTKRYLKKNQIRDWIRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.833, cyto 9.5, mito_nucl 9.333, nucl 9, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPITTKKSKAAKKFVVDTSAPVENGVFDQEGYVKYLVEHIKVEGIVGNLGDEISVTSEGTKVVVVSNTKFSGKYLKYLTKRYLKKNQIRDWIRFVAVKQNQYQLQFYSVAEDEEEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.7
3 0.66
4 0.58
5 0.51
6 0.45
7 0.39
8 0.31
9 0.24
10 0.21
11 0.15
12 0.15
13 0.14
14 0.09
15 0.06
16 0.07
17 0.08
18 0.09
19 0.1
20 0.1
21 0.09
22 0.09
23 0.14
24 0.15
25 0.15
26 0.15
27 0.13
28 0.14
29 0.13
30 0.14
31 0.09
32 0.09
33 0.07
34 0.07
35 0.06
36 0.05
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.04
50 0.04
51 0.06
52 0.07
53 0.08
54 0.11
55 0.12
56 0.13
57 0.13
58 0.13
59 0.2
60 0.19
61 0.23
62 0.26
63 0.33
64 0.38
65 0.43
66 0.5
67 0.51
68 0.58
69 0.62
70 0.67
71 0.69
72 0.73
73 0.78
74 0.79
75 0.8
76 0.79
77 0.74
78 0.71
79 0.64
80 0.57
81 0.48
82 0.41
83 0.41
84 0.4
85 0.4
86 0.37
87 0.4
88 0.41
89 0.42
90 0.43
91 0.34
92 0.32
93 0.29
94 0.26
95 0.24
96 0.21
97 0.18
98 0.16
99 0.16
100 0.14