Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8ND81

Protein Details
Accession B8ND81    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-36EVECRVLPPQPPKRRKKKLHERDLIDRLRKBasic
NLS Segment(s)
PositionSequence
17-26PPKRRKKKLH
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPLACYEVECRVLPPQPPKRRKKKLHERDLIDRLRKYEALMSQHGISFDSVLEGEYGVANLEHDTNGAGTAAEGSAQNSNPQAQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.45
3 0.53
4 0.63
5 0.72
6 0.79
7 0.86
8 0.91
9 0.92
10 0.92
11 0.93
12 0.94
13 0.92
14 0.88
15 0.86
16 0.85
17 0.8
18 0.74
19 0.64
20 0.55
21 0.48
22 0.41
23 0.33
24 0.28
25 0.24
26 0.23
27 0.23
28 0.22
29 0.2
30 0.21
31 0.2
32 0.16
33 0.12
34 0.08
35 0.07
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.05
55 0.05
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.07
62 0.1
63 0.1
64 0.12
65 0.14
66 0.15