Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367XZR4

Protein Details
Accession A0A367XZR4   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-83KYETYKTTLRRRRVRTNGHTVKRSGRRRKEDKEAEEABasic
NLS Segment(s)
PositionSequence
56-76RRRRVRTNGHTVKRSGRRRKE
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MHKKFEELLMTHKKLRALKKSDIAELLKKLKPPRLSGTDLAQVSGFKYETYKTTLRRRRVRTNGHTVKRSGRRRKEDKEAEEAAGGDDVDVGNGTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.55
3 0.56
4 0.53
5 0.57
6 0.61
7 0.62
8 0.59
9 0.58
10 0.52
11 0.46
12 0.44
13 0.43
14 0.37
15 0.38
16 0.39
17 0.4
18 0.41
19 0.42
20 0.43
21 0.43
22 0.46
23 0.44
24 0.43
25 0.43
26 0.38
27 0.34
28 0.27
29 0.21
30 0.16
31 0.15
32 0.12
33 0.06
34 0.07
35 0.07
36 0.08
37 0.13
38 0.17
39 0.21
40 0.32
41 0.4
42 0.49
43 0.58
44 0.64
45 0.69
46 0.76
47 0.8
48 0.78
49 0.81
50 0.82
51 0.8
52 0.76
53 0.68
54 0.68
55 0.67
56 0.7
57 0.69
58 0.7
59 0.73
60 0.79
61 0.84
62 0.86
63 0.86
64 0.8
65 0.78
66 0.7
67 0.61
68 0.52
69 0.45
70 0.34
71 0.25
72 0.19
73 0.11
74 0.08
75 0.07
76 0.06
77 0.06