Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367Y4A4

Protein Details
Accession A0A367Y4A4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
90-120LQAQDFLKWRKKQLRRDNKEKIKNNNFMSKLHydrophilic
NLS Segment(s)
PositionSequence
100-105KKQLRR
Subcellular Location(s) mito 17.5, cyto_mito 9.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRTISQLTPRRVAPIINTRCFSVASIIRNQAQQAGATPEGAAPKSSCPAGTVLNLKVFKKGDEPVAKEDSEYPDWLWDMLDQKKVMDTLQAQDFLKWRKKQLRRDNKEKIKNNNFMSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.44
4 0.45
5 0.45
6 0.42
7 0.41
8 0.41
9 0.34
10 0.29
11 0.25
12 0.23
13 0.27
14 0.29
15 0.3
16 0.3
17 0.29
18 0.26
19 0.22
20 0.18
21 0.15
22 0.16
23 0.15
24 0.14
25 0.14
26 0.12
27 0.13
28 0.13
29 0.12
30 0.08
31 0.09
32 0.1
33 0.11
34 0.09
35 0.09
36 0.1
37 0.11
38 0.13
39 0.15
40 0.15
41 0.2
42 0.22
43 0.21
44 0.23
45 0.22
46 0.2
47 0.19
48 0.19
49 0.21
50 0.24
51 0.27
52 0.28
53 0.3
54 0.3
55 0.27
56 0.28
57 0.25
58 0.22
59 0.2
60 0.16
61 0.14
62 0.14
63 0.14
64 0.12
65 0.09
66 0.13
67 0.15
68 0.18
69 0.17
70 0.17
71 0.18
72 0.18
73 0.17
74 0.16
75 0.15
76 0.16
77 0.19
78 0.22
79 0.21
80 0.23
81 0.27
82 0.31
83 0.38
84 0.38
85 0.44
86 0.51
87 0.6
88 0.69
89 0.76
90 0.81
91 0.82
92 0.89
93 0.91
94 0.91
95 0.93
96 0.91
97 0.91
98 0.89
99 0.89
100 0.84