Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367XNP3

Protein Details
Accession A0A367XNP3   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-32STSHSPQKQQQQQQQPSNNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR042332  Hsk3  
IPR013183  Hsk3-like  
Gene Ontology GO:0043231  C:intracellular membrane-bounded organelle  
GO:0008608  P:attachment of spindle microtubules to kinetochore  
Pfam View protein in Pfam  
PF08227  DASH_Hsk3  
Amino Acid Sequences MSDSSPDKENLHSTSHSPQKQQQQQQQPSNNNTQRKLSHLNSQMAQLNANLCDFNDLLSITCNQFQSIEKLGKIHSSIFMACHGVFEDENFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.43
3 0.43
4 0.43
5 0.47
6 0.54
7 0.62
8 0.67
9 0.68
10 0.7
11 0.75
12 0.8
13 0.81
14 0.78
15 0.73
16 0.74
17 0.72
18 0.66
19 0.59
20 0.55
21 0.48
22 0.46
23 0.49
24 0.4
25 0.42
26 0.42
27 0.43
28 0.39
29 0.4
30 0.37
31 0.3
32 0.28
33 0.19
34 0.14
35 0.12
36 0.11
37 0.09
38 0.06
39 0.08
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.09
47 0.08
48 0.11
49 0.11
50 0.11
51 0.12
52 0.13
53 0.16
54 0.2
55 0.22
56 0.2
57 0.21
58 0.22
59 0.23
60 0.23
61 0.2
62 0.17
63 0.17
64 0.17
65 0.17
66 0.18
67 0.18
68 0.16
69 0.16
70 0.15
71 0.14
72 0.14