Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367YAY8

Protein Details
Accession A0A367YAY8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKIKKPKKNGPPPEGYAKIBasic
NLS Segment(s)
PositionSequence
4-11IKKPKKNG
Subcellular Location(s) nucl 11, mito 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001748  BUD31  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01125  G10  
Amino Acid Sequences MPKIKKPKKNGPPPEGYAKIEPTLTKYRDKLKTAQQKPDPTKSKQASLWIIYELNYKISRYVYEMFKNKRISRELYDWLLLQSYVNGDLIAKWKKLGYEKLCCVNCIATNTNGGGTCVCRVPKAKLLEKDPEKVNVECVTCGCRGCASSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.75
3 0.68
4 0.61
5 0.53
6 0.45
7 0.38
8 0.33
9 0.3
10 0.34
11 0.33
12 0.36
13 0.37
14 0.45
15 0.51
16 0.55
17 0.55
18 0.56
19 0.64
20 0.66
21 0.71
22 0.7
23 0.72
24 0.75
25 0.79
26 0.75
27 0.69
28 0.72
29 0.65
30 0.62
31 0.54
32 0.54
33 0.48
34 0.43
35 0.4
36 0.31
37 0.28
38 0.23
39 0.24
40 0.18
41 0.17
42 0.15
43 0.14
44 0.14
45 0.14
46 0.14
47 0.14
48 0.18
49 0.19
50 0.25
51 0.32
52 0.34
53 0.4
54 0.46
55 0.45
56 0.46
57 0.45
58 0.43
59 0.4
60 0.42
61 0.38
62 0.33
63 0.32
64 0.27
65 0.24
66 0.2
67 0.15
68 0.1
69 0.07
70 0.05
71 0.05
72 0.05
73 0.05
74 0.04
75 0.05
76 0.11
77 0.13
78 0.13
79 0.13
80 0.14
81 0.16
82 0.21
83 0.29
84 0.3
85 0.36
86 0.4
87 0.48
88 0.48
89 0.45
90 0.42
91 0.35
92 0.31
93 0.28
94 0.26
95 0.19
96 0.2
97 0.2
98 0.2
99 0.18
100 0.16
101 0.12
102 0.11
103 0.12
104 0.13
105 0.13
106 0.15
107 0.18
108 0.23
109 0.29
110 0.36
111 0.43
112 0.47
113 0.52
114 0.59
115 0.61
116 0.63
117 0.58
118 0.57
119 0.53
120 0.46
121 0.45
122 0.39
123 0.36
124 0.31
125 0.29
126 0.26
127 0.24
128 0.24
129 0.21
130 0.18