Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367Y6S5

Protein Details
Accession A0A367Y6S5    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
349-368MLTKLSKAVQTRRSLKKQKVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5cyto_nucl 14.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR006218  DAHP1/KDSA  
IPR006219  DAHP_synth_1  
Gene Ontology GO:0003849  F:3-deoxy-7-phosphoheptulonate synthase activity  
GO:0008652  P:amino acid biosynthetic process  
GO:0009073  P:aromatic amino acid family biosynthetic process  
Pfam View protein in Pfam  
PF00793  DAHP_synth_1  
Amino Acid Sequences MTKTPVPTEYDDTRILGYDPLVPPALLQHEIKASAESLEVVIRGRVDSSNILKGTDDRCLVIVGPCSIHDPEAALEYGKRLKQLSDELKDDLVIIMRAYLEKPRTTVGWKGLINDPDVDNSFDINRGLKISRQLYSDLTSITGLPIGSEMLDTISPQYFSDFLSFGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLTVALDACQASSKGHHFMGVTKNGMAAITTTKGNDNCFIILRGGKGCTNYDAESVQAAKAAIAKSTDPNIKLMVDCSHGNSSKDYRNQPKVLDSVAEQISNGEDAVIGVMIESNIHEGNQSMPPAGSNKECLKYGVSITDGCVSWETTVDMLTKLSKAVQTRRSLKKQKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.2
4 0.17
5 0.19
6 0.18
7 0.2
8 0.2
9 0.19
10 0.18
11 0.2
12 0.23
13 0.19
14 0.19
15 0.19
16 0.2
17 0.22
18 0.22
19 0.2
20 0.17
21 0.14
22 0.14
23 0.12
24 0.1
25 0.1
26 0.1
27 0.09
28 0.1
29 0.1
30 0.09
31 0.11
32 0.1
33 0.12
34 0.17
35 0.21
36 0.27
37 0.26
38 0.27
39 0.26
40 0.29
41 0.29
42 0.28
43 0.25
44 0.19
45 0.19
46 0.2
47 0.2
48 0.18
49 0.19
50 0.15
51 0.15
52 0.14
53 0.17
54 0.17
55 0.16
56 0.14
57 0.12
58 0.11
59 0.13
60 0.13
61 0.1
62 0.1
63 0.13
64 0.18
65 0.18
66 0.19
67 0.18
68 0.19
69 0.22
70 0.31
71 0.37
72 0.38
73 0.39
74 0.38
75 0.38
76 0.37
77 0.33
78 0.24
79 0.16
80 0.11
81 0.08
82 0.07
83 0.07
84 0.07
85 0.08
86 0.13
87 0.15
88 0.15
89 0.17
90 0.18
91 0.19
92 0.22
93 0.26
94 0.25
95 0.29
96 0.29
97 0.31
98 0.35
99 0.34
100 0.32
101 0.29
102 0.25
103 0.2
104 0.2
105 0.18
106 0.14
107 0.13
108 0.12
109 0.11
110 0.11
111 0.1
112 0.09
113 0.1
114 0.11
115 0.12
116 0.18
117 0.2
118 0.22
119 0.23
120 0.24
121 0.24
122 0.26
123 0.25
124 0.18
125 0.16
126 0.14
127 0.12
128 0.1
129 0.09
130 0.06
131 0.06
132 0.05
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.06
142 0.06
143 0.06
144 0.07
145 0.07
146 0.08
147 0.09
148 0.08
149 0.08
150 0.08
151 0.08
152 0.07
153 0.08
154 0.08
155 0.06
156 0.06
157 0.07
158 0.06
159 0.07
160 0.11
161 0.11
162 0.13
163 0.15
164 0.15
165 0.15
166 0.15
167 0.15
168 0.11
169 0.1
170 0.08
171 0.07
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.05
179 0.08
180 0.08
181 0.09
182 0.09
183 0.08
184 0.08
185 0.09
186 0.08
187 0.06
188 0.05
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.06
197 0.08
198 0.11
199 0.11
200 0.13
201 0.13
202 0.17
203 0.22
204 0.23
205 0.22
206 0.2
207 0.2
208 0.18
209 0.18
210 0.13
211 0.08
212 0.07
213 0.07
214 0.08
215 0.08
216 0.11
217 0.12
218 0.14
219 0.14
220 0.14
221 0.14
222 0.14
223 0.14
224 0.13
225 0.13
226 0.13
227 0.13
228 0.14
229 0.14
230 0.15
231 0.15
232 0.16
233 0.17
234 0.17
235 0.17
236 0.15
237 0.14
238 0.14
239 0.14
240 0.11
241 0.1
242 0.09
243 0.08
244 0.11
245 0.11
246 0.1
247 0.11
248 0.12
249 0.13
250 0.18
251 0.22
252 0.2
253 0.21
254 0.21
255 0.21
256 0.2
257 0.2
258 0.17
259 0.16
260 0.16
261 0.18
262 0.22
263 0.23
264 0.24
265 0.26
266 0.29
267 0.33
268 0.4
269 0.46
270 0.5
271 0.56
272 0.58
273 0.57
274 0.57
275 0.51
276 0.46
277 0.38
278 0.3
279 0.27
280 0.25
281 0.23
282 0.18
283 0.16
284 0.16
285 0.14
286 0.13
287 0.06
288 0.05
289 0.05
290 0.05
291 0.05
292 0.04
293 0.03
294 0.04
295 0.04
296 0.04
297 0.04
298 0.06
299 0.06
300 0.06
301 0.07
302 0.07
303 0.1
304 0.14
305 0.14
306 0.13
307 0.13
308 0.14
309 0.17
310 0.2
311 0.19
312 0.22
313 0.27
314 0.29
315 0.3
316 0.3
317 0.3
318 0.3
319 0.3
320 0.27
321 0.24
322 0.21
323 0.22
324 0.25
325 0.22
326 0.2
327 0.19
328 0.17
329 0.15
330 0.16
331 0.15
332 0.11
333 0.12
334 0.12
335 0.12
336 0.12
337 0.13
338 0.13
339 0.13
340 0.15
341 0.18
342 0.25
343 0.33
344 0.4
345 0.48
346 0.58
347 0.67
348 0.76