Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367YGB4

Protein Details
Accession A0A367YGB4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-40AALAGGKKGKKKWNKGKVKDKAQHVVHydrophilic
NLS Segment(s)
PositionSequence
13-35AAAALAGGKKGKKKWNKGKVKDK
Subcellular Location(s) cyto 17, mito 7.5, mito_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPKVQQTKAAKAAAALAGGKKGKKKWNKGKVKDKAQHVVILDQEKYDRILKDVPTYKYVSVSVLVDRLKIGGSLARVALKQLEEDGIITPVLKHSKQSIYTRAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.2
4 0.13
5 0.16
6 0.19
7 0.21
8 0.23
9 0.29
10 0.37
11 0.46
12 0.57
13 0.63
14 0.72
15 0.8
16 0.85
17 0.9
18 0.9
19 0.91
20 0.87
21 0.83
22 0.79
23 0.69
24 0.62
25 0.52
26 0.44
27 0.36
28 0.31
29 0.25
30 0.18
31 0.16
32 0.13
33 0.14
34 0.15
35 0.13
36 0.12
37 0.15
38 0.15
39 0.22
40 0.27
41 0.27
42 0.27
43 0.29
44 0.27
45 0.26
46 0.25
47 0.19
48 0.14
49 0.13
50 0.11
51 0.13
52 0.12
53 0.11
54 0.11
55 0.1
56 0.09
57 0.08
58 0.08
59 0.07
60 0.08
61 0.08
62 0.09
63 0.11
64 0.1
65 0.11
66 0.13
67 0.11
68 0.11
69 0.11
70 0.1
71 0.09
72 0.1
73 0.1
74 0.09
75 0.09
76 0.09
77 0.08
78 0.12
79 0.17
80 0.16
81 0.18
82 0.23
83 0.3
84 0.37
85 0.44