Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367XY13

Protein Details
Accession A0A367XY13   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-85VFVGKVLVKNQQKQKSKKKSQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7E.R. 7, mito 6, golg 3, vacu 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MSFDKLIGLGMLGVAAFVFIYYTAWVFVLPFIDEDNYLNQFFLPRDYAIKLPLLLLLIAGVGVGVFVGKVLVKNQQKQKSKKKSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.02
5 0.02
6 0.02
7 0.03
8 0.04
9 0.04
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.07
21 0.08
22 0.09
23 0.1
24 0.1
25 0.1
26 0.09
27 0.1
28 0.09
29 0.1
30 0.09
31 0.08
32 0.09
33 0.11
34 0.12
35 0.12
36 0.13
37 0.11
38 0.1
39 0.1
40 0.09
41 0.07
42 0.06
43 0.05
44 0.04
45 0.04
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.01
53 0.02
54 0.02
55 0.03
56 0.04
57 0.06
58 0.15
59 0.22
60 0.31
61 0.41
62 0.51
63 0.61
64 0.7
65 0.8