Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367Y196

Protein Details
Accession A0A367Y196   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
70-125KRKQAEKEKELKKKKQEEEKLEKEKKKEEERLERERKKEAERLQKERRSKRRNESGBasic
NLS Segment(s)
PositionSequence
35-123KEKRELARIEREKKKEEERQEKLERKRKQDEERELKRKQAEKEKELKKKKQEEEKLEKEKKKEEERLERERKKEAERLQKERRSKRRNE
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MVWRTVSKRKAETEEPEPSTTPTKKSKTNETITAKEKRELARIEREKKKEEERQEKLERKRKQDEERELKRKQAEKEKELKKKKQEEEKLEKEKKKEEERLERERKKEAERLQKERRSKRRNESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.6
3 0.56
4 0.51
5 0.46
6 0.47
7 0.42
8 0.4
9 0.4
10 0.4
11 0.46
12 0.5
13 0.58
14 0.59
15 0.63
16 0.67
17 0.65
18 0.67
19 0.65
20 0.68
21 0.6
22 0.53
23 0.52
24 0.44
25 0.44
26 0.41
27 0.4
28 0.43
29 0.49
30 0.56
31 0.6
32 0.62
33 0.61
34 0.62
35 0.65
36 0.62
37 0.64
38 0.65
39 0.62
40 0.66
41 0.71
42 0.74
43 0.75
44 0.76
45 0.72
46 0.69
47 0.73
48 0.72
49 0.72
50 0.73
51 0.74
52 0.75
53 0.79
54 0.79
55 0.71
56 0.68
57 0.65
58 0.61
59 0.57
60 0.57
61 0.55
62 0.55
63 0.64
64 0.69
65 0.73
66 0.77
67 0.78
68 0.78
69 0.8
70 0.81
71 0.81
72 0.81
73 0.81
74 0.82
75 0.84
76 0.85
77 0.84
78 0.8
79 0.74
80 0.72
81 0.71
82 0.7
83 0.69
84 0.68
85 0.7
86 0.73
87 0.79
88 0.83
89 0.81
90 0.76
91 0.75
92 0.71
93 0.66
94 0.67
95 0.66
96 0.66
97 0.68
98 0.75
99 0.77
100 0.8
101 0.84
102 0.86
103 0.88
104 0.87
105 0.87