Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NY19

Protein Details
Accession B8NY19    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-25GVMSRKCSEKRGKESCKAGKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
Gene Ontology GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
CDD cd04301  NAT_SF  
Amino Acid Sequences MYPHGVMSRKCSEKRGKESCKAGKAMGYTVSRQQAKAFSSFVDPSALGIVFMAVAPHHQRQGVGSTLLKMLCDYVDEREY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.74
4 0.74
5 0.81
6 0.81
7 0.77
8 0.69
9 0.6
10 0.52
11 0.44
12 0.38
13 0.34
14 0.27
15 0.22
16 0.24
17 0.3
18 0.28
19 0.27
20 0.26
21 0.24
22 0.24
23 0.24
24 0.2
25 0.14
26 0.16
27 0.16
28 0.15
29 0.13
30 0.11
31 0.1
32 0.1
33 0.09
34 0.06
35 0.06
36 0.05
37 0.04
38 0.04
39 0.04
40 0.03
41 0.05
42 0.09
43 0.1
44 0.12
45 0.12
46 0.13
47 0.14
48 0.18
49 0.18
50 0.18
51 0.17
52 0.17
53 0.19
54 0.19
55 0.18
56 0.15
57 0.13
58 0.1
59 0.12
60 0.12