Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YP08

Protein Details
Accession A0A367YP08    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-33ITPQTPPRPERRRSNPTAATPFQHydrophilic
203-230LINNKTGKKRIVKLTKNQMKIKPKKLSFHydrophilic
NLS Segment(s)
PositionSequence
210-226KKRIVKLTKNQMKIKPK
Subcellular Location(s) nucl 18, mito_nucl 12.166, cyto_nucl 11.666, cyto_mito 5.166, mito 5
Family & Domain DBs
Amino Acid Sequences MSPADSPSIFITPQTPPRPERRRSNPTAATPFQSNPLLTPSTATKKQAKSPVAIRRKQDTLLTGKFPFTPATPQKSPCKSKKNLDLFISNNEKFGILLPSPSTIGSGRCHNSTLSQGPPPPVFDMKKLHEFKVPGTPKKQIITEPTLPESDDEDDWELTTMSEVDKIPRANMSNPFIDNGESKPTAPAQSHHNGINYDTHMELINNKTGKKRIVKLTKNQMKIKPKKLSFDGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.41
4 0.52
5 0.61
6 0.66
7 0.71
8 0.72
9 0.76
10 0.78
11 0.84
12 0.81
13 0.8
14 0.8
15 0.72
16 0.66
17 0.59
18 0.52
19 0.46
20 0.4
21 0.32
22 0.24
23 0.25
24 0.23
25 0.19
26 0.2
27 0.22
28 0.27
29 0.3
30 0.34
31 0.38
32 0.41
33 0.49
34 0.55
35 0.52
36 0.51
37 0.56
38 0.61
39 0.63
40 0.64
41 0.62
42 0.59
43 0.59
44 0.56
45 0.5
46 0.44
47 0.42
48 0.4
49 0.4
50 0.35
51 0.33
52 0.31
53 0.29
54 0.25
55 0.19
56 0.24
57 0.26
58 0.32
59 0.35
60 0.39
61 0.47
62 0.54
63 0.62
64 0.62
65 0.65
66 0.64
67 0.69
68 0.75
69 0.75
70 0.72
71 0.67
72 0.63
73 0.56
74 0.56
75 0.55
76 0.44
77 0.36
78 0.3
79 0.26
80 0.21
81 0.2
82 0.16
83 0.09
84 0.1
85 0.09
86 0.1
87 0.1
88 0.1
89 0.11
90 0.08
91 0.1
92 0.11
93 0.15
94 0.16
95 0.16
96 0.17
97 0.16
98 0.16
99 0.18
100 0.19
101 0.17
102 0.17
103 0.18
104 0.19
105 0.19
106 0.19
107 0.18
108 0.19
109 0.18
110 0.19
111 0.23
112 0.24
113 0.33
114 0.34
115 0.33
116 0.33
117 0.33
118 0.31
119 0.37
120 0.4
121 0.35
122 0.36
123 0.39
124 0.39
125 0.4
126 0.4
127 0.33
128 0.32
129 0.35
130 0.36
131 0.34
132 0.33
133 0.31
134 0.29
135 0.27
136 0.23
137 0.18
138 0.13
139 0.12
140 0.12
141 0.12
142 0.12
143 0.12
144 0.09
145 0.07
146 0.07
147 0.06
148 0.05
149 0.07
150 0.08
151 0.09
152 0.13
153 0.14
154 0.14
155 0.17
156 0.2
157 0.21
158 0.27
159 0.29
160 0.28
161 0.29
162 0.29
163 0.26
164 0.25
165 0.22
166 0.18
167 0.2
168 0.18
169 0.17
170 0.18
171 0.19
172 0.21
173 0.21
174 0.21
175 0.23
176 0.27
177 0.3
178 0.3
179 0.31
180 0.29
181 0.29
182 0.32
183 0.26
184 0.23
185 0.2
186 0.19
187 0.16
188 0.16
189 0.19
190 0.18
191 0.23
192 0.23
193 0.25
194 0.3
195 0.34
196 0.42
197 0.46
198 0.51
199 0.55
200 0.64
201 0.71
202 0.76
203 0.82
204 0.84
205 0.84
206 0.85
207 0.83
208 0.83
209 0.84
210 0.84
211 0.84
212 0.8
213 0.8