Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YHK1

Protein Details
Accession A0A367YHK1   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-33SATTSRKKLHNFKCNFNYKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019448  NT-C2  
Pfam View protein in Pfam  
PF10358  NT-C2  
Amino Acid Sequences MKEGMTSSLSGNVSATTSRKKLHNFKCNFNYKLSYINLSEYLNFDDLITTKYLLNDSKVNSILSLTIGLNELPPNFDSTPNTSNLLGRPTTTRKNNFNVPQFEKKNVFNGIGNVFGENGAFNGTPPTSPSTPVENGQPQLGSVDGAKTESNLSLANKGNSQQDAQPQLLQQILMDPIVSQLYCKILESSWDPELYTLLTYSQSNKQDDEEELRKLDDSYRELNGLISEVKYRPDLKSWNIPEGDLPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.2
4 0.23
5 0.27
6 0.33
7 0.42
8 0.52
9 0.6
10 0.67
11 0.66
12 0.73
13 0.79
14 0.82
15 0.75
16 0.69
17 0.63
18 0.54
19 0.55
20 0.47
21 0.41
22 0.33
23 0.33
24 0.3
25 0.26
26 0.26
27 0.21
28 0.21
29 0.18
30 0.16
31 0.13
32 0.12
33 0.12
34 0.13
35 0.12
36 0.11
37 0.11
38 0.11
39 0.14
40 0.14
41 0.16
42 0.19
43 0.2
44 0.23
45 0.23
46 0.22
47 0.2
48 0.19
49 0.17
50 0.13
51 0.13
52 0.09
53 0.08
54 0.08
55 0.08
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.13
62 0.13
63 0.14
64 0.16
65 0.2
66 0.23
67 0.23
68 0.25
69 0.21
70 0.21
71 0.21
72 0.22
73 0.17
74 0.15
75 0.18
76 0.22
77 0.29
78 0.35
79 0.4
80 0.42
81 0.47
82 0.54
83 0.56
84 0.58
85 0.58
86 0.57
87 0.6
88 0.57
89 0.56
90 0.52
91 0.46
92 0.42
93 0.37
94 0.32
95 0.23
96 0.23
97 0.2
98 0.18
99 0.17
100 0.13
101 0.11
102 0.09
103 0.08
104 0.06
105 0.05
106 0.05
107 0.04
108 0.04
109 0.05
110 0.06
111 0.06
112 0.07
113 0.11
114 0.1
115 0.12
116 0.13
117 0.17
118 0.18
119 0.19
120 0.22
121 0.2
122 0.2
123 0.19
124 0.17
125 0.13
126 0.12
127 0.11
128 0.08
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.06
135 0.07
136 0.06
137 0.07
138 0.08
139 0.09
140 0.13
141 0.15
142 0.15
143 0.16
144 0.17
145 0.19
146 0.19
147 0.19
148 0.17
149 0.21
150 0.23
151 0.23
152 0.23
153 0.21
154 0.21
155 0.2
156 0.17
157 0.12
158 0.1
159 0.09
160 0.08
161 0.08
162 0.06
163 0.07
164 0.08
165 0.07
166 0.06
167 0.06
168 0.08
169 0.09
170 0.1
171 0.1
172 0.09
173 0.12
174 0.16
175 0.19
176 0.19
177 0.19
178 0.19
179 0.18
180 0.18
181 0.16
182 0.13
183 0.09
184 0.08
185 0.09
186 0.1
187 0.13
188 0.2
189 0.25
190 0.26
191 0.27
192 0.28
193 0.29
194 0.32
195 0.36
196 0.33
197 0.3
198 0.29
199 0.29
200 0.28
201 0.26
202 0.27
203 0.24
204 0.25
205 0.26
206 0.27
207 0.27
208 0.27
209 0.27
210 0.23
211 0.19
212 0.16
213 0.13
214 0.15
215 0.15
216 0.17
217 0.21
218 0.23
219 0.24
220 0.29
221 0.34
222 0.37
223 0.47
224 0.49
225 0.53
226 0.51
227 0.49