Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N5N6

Protein Details
Accession B8N5N6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
122-141FVWACWACDRRRKQPNKTSIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, vacu 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTDKNYLVQDGHPAILLLRIAAIVSAFTTLVVFAWAIKAHDRVYTDIDGASLCAMILATASYAVIWSLVPLTVRLLVRRTLHLGVYIAFDFIAYGAVFATTVVTMILLIPNAESGVLHFVLFVWACWACDRRRKQPNKTSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.15
4 0.09
5 0.07
6 0.06
7 0.06
8 0.06
9 0.06
10 0.04
11 0.04
12 0.05
13 0.04
14 0.04
15 0.05
16 0.04
17 0.05
18 0.05
19 0.05
20 0.04
21 0.06
22 0.06
23 0.07
24 0.09
25 0.11
26 0.11
27 0.14
28 0.16
29 0.16
30 0.19
31 0.19
32 0.18
33 0.16
34 0.15
35 0.13
36 0.11
37 0.09
38 0.05
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.03
52 0.02
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.05
59 0.07
60 0.08
61 0.09
62 0.1
63 0.14
64 0.15
65 0.16
66 0.19
67 0.17
68 0.17
69 0.17
70 0.16
71 0.13
72 0.14
73 0.12
74 0.09
75 0.08
76 0.07
77 0.06
78 0.06
79 0.06
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.1
108 0.11
109 0.1
110 0.1
111 0.1
112 0.11
113 0.14
114 0.18
115 0.21
116 0.31
117 0.39
118 0.46
119 0.57
120 0.66
121 0.74