Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367YP77

Protein Details
Accession A0A367YP77    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-68RECFRRSSYKNWGPRQRPENDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 9, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPINNQPITRAKPAAYTPWLGVGAILLAGGAYMLYNRTPRHEAGCNCRECFRRSSYKNWGPRQRPENDIIKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.32
4 0.27
5 0.27
6 0.27
7 0.22
8 0.19
9 0.12
10 0.09
11 0.07
12 0.06
13 0.03
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.03
21 0.04
22 0.06
23 0.07
24 0.11
25 0.13
26 0.14
27 0.19
28 0.25
29 0.28
30 0.35
31 0.42
32 0.43
33 0.42
34 0.46
35 0.45
36 0.42
37 0.43
38 0.41
39 0.43
40 0.44
41 0.51
42 0.57
43 0.63
44 0.69
45 0.75
46 0.79
47 0.75
48 0.81
49 0.81
50 0.75
51 0.72
52 0.68