Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YMX4

Protein Details
Accession A0A367YMX4   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-33LKDLNAEKRKFQPRRKFRYFRVQKEGQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003196  TFIIF_beta  
IPR040450  TFIIF_beta_HTH  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005674  C:transcription factor TFIIF complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF02270  TFIIF_beta  
Amino Acid Sequences MPEQPQLKDLNAEKRKFQPRRKFRYFRVQKEGQDGQPVKNTSVFLRSSQGKNKSEGRAIRMPKKDLLDLLFRLFEEYEYWSMKGLKERTRQPSRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.64
3 0.67
4 0.73
5 0.73
6 0.75
7 0.84
8 0.89
9 0.88
10 0.85
11 0.87
12 0.86
13 0.84
14 0.82
15 0.79
16 0.71
17 0.7
18 0.67
19 0.57
20 0.56
21 0.48
22 0.41
23 0.4
24 0.38
25 0.31
26 0.28
27 0.27
28 0.19
29 0.21
30 0.2
31 0.15
32 0.18
33 0.21
34 0.22
35 0.28
36 0.35
37 0.33
38 0.36
39 0.4
40 0.39
41 0.41
42 0.41
43 0.4
44 0.4
45 0.44
46 0.49
47 0.48
48 0.48
49 0.47
50 0.47
51 0.42
52 0.36
53 0.34
54 0.3
55 0.27
56 0.26
57 0.22
58 0.2
59 0.2
60 0.18
61 0.15
62 0.12
63 0.14
64 0.15
65 0.17
66 0.17
67 0.17
68 0.19
69 0.21
70 0.28
71 0.31
72 0.37
73 0.43
74 0.52
75 0.61