Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367YL45

Protein Details
Accession A0A367YL45   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-103RSYKTKRSFARAPPRKQKQTEFLHydrophilic
NLS Segment(s)
PositionSequence
54-54K
60-97KFKELLDNKAKEPRGNRSNEPRSYKTKRSFARAPPRKQ
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MAKEPRDDKSKEPPVKRAMEFLDNIAKEHRGERSKEPPVERANELLEPRGERSKEPPVEKFKELLDNKAKEPRGNRSNEPRSYKTKRSFARAPPRKQKQTEFLSNSSNNAPKVSVPPVST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.67
4 0.61
5 0.55
6 0.51
7 0.46
8 0.41
9 0.41
10 0.33
11 0.33
12 0.29
13 0.26
14 0.22
15 0.23
16 0.27
17 0.24
18 0.28
19 0.34
20 0.42
21 0.49
22 0.54
23 0.54
24 0.53
25 0.52
26 0.53
27 0.47
28 0.4
29 0.33
30 0.31
31 0.29
32 0.24
33 0.2
34 0.17
35 0.18
36 0.21
37 0.2
38 0.18
39 0.22
40 0.29
41 0.33
42 0.35
43 0.4
44 0.42
45 0.46
46 0.46
47 0.43
48 0.35
49 0.38
50 0.36
51 0.37
52 0.37
53 0.34
54 0.35
55 0.41
56 0.41
57 0.35
58 0.38
59 0.4
60 0.4
61 0.43
62 0.47
63 0.51
64 0.59
65 0.63
66 0.67
67 0.62
68 0.64
69 0.67
70 0.7
71 0.68
72 0.68
73 0.65
74 0.66
75 0.69
76 0.7
77 0.74
78 0.75
79 0.77
80 0.79
81 0.85
82 0.86
83 0.85
84 0.82
85 0.79
86 0.78
87 0.78
88 0.74
89 0.67
90 0.65
91 0.59
92 0.54
93 0.51
94 0.46
95 0.37
96 0.32
97 0.29
98 0.24
99 0.28
100 0.3